Property Summary

Ligand Count 280
NCBI Gene PubMed Count 542
PubMed Score 1599.38
PubTator Score 1115.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (34)

Disease log2 FC p
aldosterone-producing adenoma -2.196 2.4e-02
astrocytic glioma 1.700 1.6e-02
Astrocytoma, Pilocytic 1.700 2.4e-06
atypical teratoid / rhabdoid tumor 1.600 5.9e-03
breast carcinoma -1.100 1.3e-16
chronic rhinosinusitis -1.020 2.1e-02
COPD -1.200 2.5e-02
cutaneous lupus erythematosus 1.500 7.1e-03
diabetes mellitus -1.100 2.4e-02
Down syndrome 1.400 4.2e-04
ependymoma 1.500 2.2e-02
gastric cancer -2.300 3.8e-02
Gaucher disease type 1 -1.700 8.8e-03
glioblastoma 1.700 7.9e-08
group 3 medulloblastoma 1.100 6.1e-03
hereditary spastic paraplegia -1.530 1.4e-02
interstitial cystitis 1.100 3.2e-04
interstitial lung disease -1.300 4.3e-02
invasive ductal carcinoma 1.200 1.6e-02
lung cancer -2.200 2.4e-05
lung carcinoma -1.300 4.7e-19
medulloblastoma, large-cell 1.400 1.3e-02
non-small cell lung cancer -3.378 1.3e-27
osteosarcoma 3.826 2.0e-05
ovarian cancer 1.400 7.7e-05
pancreatic cancer 1.400 2.2e-02
pancreatic ductal adenocarcinoma liver m... 1.322 1.2e-02
pediatric high grade glioma 1.300 3.1e-02
Pick disease 1.100 2.0e-04
Polycystic ovary syndrome -1.190 3.3e-03
primitive neuroectodermal tumor 1.300 1.4e-04
psoriasis 1.800 2.2e-05
subependymal giant cell astrocytoma 1.821 3.1e-02
ulcerative colitis 1.400 4.8e-04

PDB (49)

Gene RIF (501)

AA Sequence

MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLT      1 - 70
PDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAV     71 - 140
LPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKAL    141 - 210
ETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKT    211 - 280
INQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR    281 - 350
//

Text Mined References (547)

PMID Year Title