Property Summary

NCBI Gene PubMed Count 474
PubMed Score 1469.21
PubTator Score 1115.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (34)

Disease log2 FC p
gastric carcinoma 2.600 5.7e-03
interstitial lung disease -1.300 4.3e-02
astrocytic glioma 1.700 1.6e-02
posterior fossa group A ependymoma 1.700 1.7e-09
psoriasis 1.800 2.2e-05
cutaneous lupus erythematosus 1.500 7.1e-03
glioblastoma 2.700 7.8e-05
osteosarcoma 3.826 2.0e-05
medulloblastoma 1.400 3.1e-06
atypical teratoid / rhabdoid tumor 1.800 7.3e-07
medulloblastoma, large-cell 1.400 1.3e-02
primitive neuroectodermal tumor 1.300 1.4e-04
hereditary spastic paraplegia -1.530 1.4e-02
primary pancreatic ductal adenocarcinoma 1.416 5.7e-03
non-small cell lung cancer -3.378 1.3e-27
lung cancer -2.200 2.4e-05
diabetes mellitus -1.100 2.4e-02
interstitial cystitis 1.200 1.8e-05
pediatric high grade glioma 2.000 5.9e-07
pilocytic astrocytoma 1.700 1.7e-06
aldosterone-producing adenoma -2.196 2.4e-02
subependymal giant cell astrocytoma 1.821 3.1e-02
COPD -1.200 2.5e-02
Polycystic Ovary Syndrome -1.190 3.3e-03
lung carcinoma -1.300 4.7e-19
breast carcinoma -1.100 1.3e-16
Pick disease 1.100 2.0e-04
invasive ductal carcinoma 1.200 1.6e-02
ulcerative colitis 1.400 4.8e-04
ovarian cancer 1.500 5.6e-03
Gaucher disease type 1 -1.700 8.8e-03
Down syndrome 1.400 4.2e-04
chronic rhinosinusitis -1.020 2.1e-02
pancreatic cancer 1.400 2.2e-02

MLP Assay (17)

AID Type Active / Inconclusive / Inactive Description
1009 screening 196 / 446 / 194215 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Mcl-1
1021 screening 2130 / 0 / 216658 uHTS of Mcl-1/Bid interaction inhibitors
1022 screening 3336 / 0 / 214179 uHTS of Mcl-1/Noxa interaction inhibitors
1329 confirmatory 3 / 0 / 831 Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Mcl-1.
1417 confirmatory 875 / 0 / 239 Dose Response Confirmation for Mcl-1/Noxa Interaction Inhibitors
1418 confirmatory 509 / 0 / 667 Dose Response Confirmation for Mcl-1/Bid Interaction Inhibitors
2057 screening 2141 / 0 / 312959 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of myeloid cell leukemia sequence 1 (MCL1) interactions with BIM-BH3 peptide.
2086 confirmatory 0 / 0 / 42 Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Mcl-1
2090 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of myeloid cell leukemia sequence 1 (MCL1) interactions with BIM-BH3 peptide.
2168 screening 1050 / 0 / 670 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of myeloid cell leukemia sequence 1 (MCL1) interactions with BIM-BH3 peptide.
More...

Gene RIF (436)

PMID Text
27455555 the FoxM1/Mcl-1 pathway may overcome cispaltin resistance of gastric cancer and provide a new therapeutic target for the treatment of gastric cancer
27063186 JAK3 and MCL-1 were down-regulated in patient CD8(+) T cells versus their normal counterparts, likely due to defective suppressor activity of miR-29b and miR-198 in RCC CD8(+) T cells.
27049076 Mcl-1 plays a fundamental role in the survival and resistance of U-937 cells to etoposide.
26921175 Our data demonstrate a critical role of Mcl-1 in Her2-positive BC cell survival under hypoxic conditions and provide the preclinical framework for the therapeutic use of novel Mcl-1- targeting agents to improve patient outcome in breast cancer .
26739047 The authors now show that human cytomegalovirus more robustly upregulated Mcl-1 than normal myeloid growth factors and that Mcl-1 was the only myeloid survival factor to rapidly induce HSP27 prior to the 48-h cell fate checkpoint.
26720004 Bay 61-3606 downregulates Mcl-1 expression in breast cancer cells and sensitizes cancer cells to TRAIL-mediated apoptosis.
26718267 miR-101 is a negative regulator of Mcl-1 in hepatocellular carcinoma.
26636651 identify high copy number gain of MCL1 (chromosome 1q) and loss of CDKN2A (P16, chromosome 9p) in metastatic BRAF
26610208 Bak activates upon loss of anti-apoptotic Bcl-XL and Mcl-1 but in the absence of active BH3-only proteins.
26540567 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3Kdelta or PKCbeta signaling pathways.
26538029 Data indicate that the balance between the long and short variants of the Mcl-1 gene represents a key aspect of the regulation of mitochondrial physiology.
26526790 miR-193b sensitizes MCF-7/DOXR cells to doxorubicin through a mechanism involving the downregulation of MCL-1
26522352 MCL1 with the deletion of 801G and 802A sites could not be correctly spliced by ESRP1 and no significant difference was seen in the expressions of isoform 1 and 3 in mutant MCL1
26504803 Upregulation of miR-125b inhibited the proliferation and metastasis of gastric cancer cells in vitro and in vivo. miR-125b elicits these responses by directly targeting MCL1, which results in a marked reduction in MCL1 expression.
26497853 Overexpression of Mcl-1 confers resistance to BRAFV600E inhibitors alone and in combination with MEK1/2 inhibitors in melanoma.
26452980 Co-administration of the mTORC1/TORC2 inhibitor INK128 and the Bcl-2/Bcl-xL antagonist ABT-737 kills human myeloid leukemia cells through Mcl-1 down-regulation and AKT inactivation.
26384220 results reveal GILZ to be a new actor in apoptosis regulation in neutrophil-like cells involving JNK and Mcl-1.
26323360 The mechanisms involved in 17-DR-induced apoptosis included the downregulation of myeloid cell leukemia-1 (Mcl-1), and upregulation of Bcl-2 antagonist killer 1 (Bak).
26314849 AZD5582 draws Mcl-1 down-regulation for induction of apoptosis through targeting of cIAP1 and XIAP in human pancreatic cancer
26297542 miR-125a-5p inhibits cell proliferation and induces apoptosis in colon cancer cells via targeting BCL2, BCL2L12 and Mcl-1.
26296968 Data show that leukemia inhibitory factor (LIF) signaling promote chemoresistance in cholangiocarcinoma by up-regulating myeloid cell factor-1 (Mcl-1) via phosphatidylinositol 3-kinase (PI3K)/c-akt protein (AKT)-dependent pathway.
26258756 Reduced miR-512 and the elevated expression of its targets cFLIP and MCL1 localize to neurons with hyperphosphorylated Tau protein in Alzheimer disease.
26219338 our findings identify a novel mechanism of cyclin E-mediated Mcl-1 regulation in human cancer
26205817 Data indicate that an internal loop domain of myeloid cell leukemia sequence 1 protein (Mcl-1) is responsible for antisenescence functions.
26184999 These results suggest that STAT3 inhibition, by down-regulating the expression of HSF1/HSP70, reduces Mcl-1 and leads to both apoptosis and autophagy induction in PEL cells.
26143754 Downregulation of miR-363 resulted in upregulation of Mcl-1 which is a key member of anti-apoptotic Bcl-2 family and increased drug resistance in HepG2 cells.
26097563 altered expression of miR-20a and miR-29b may cooperatively contribute to the neuronal cell death of SCI through down-regulating anti-apoptotic myeloid cell leukemia sequence-1 (Mcl-1) and up-regulating pro-apoptotic BH3-only proteins.
26096930 In the acquired resistance setting, MCL1 suppression in response to HSP90 inhibitors is maintained; however, a switch in MCL1 dependence occurs
26078955 miR-26b was a negative regulator of Mcl-1 gene and sensitized TRAIL-inducing apoptosis in HCC cells, suggesting that the miR-26b-Mcl-1 pathway might be a novel target for the treatment of Hepatocellular Carcinoma .
26068790 The results point at Mcl-1 as a ubiquitous factor, downregulated by Cardiac glycosides, whose modulation is essential to achieve cell death.
26063499 LA provoked a down regulation of two anti-apoptotic proteins, Mcl-1 and Bcl-xL protein and a strong induction of the BH3-only protein Bim.
26058661 Results indicate that Mcl-1 expression induces epithelial-mesenchymal transition via beta-catenin, MEK1/2 and MAPK signaling pathways, which subsequently stimulates the invasive and migratory capacity of human gastric cancer cells.
26056043 anti-apoptotic proteins Mcl-1 and Bcl-2 are suppressed by metformin combined with aspirin, which significantly inhibit pancreatic cancer cell growth
26052614 The identification of laminin gamma 1 (LAMC1) and myeloid cell leukemia 1 (MCL1) as direct targets of miR-22 and miR-29a, respectively, suggested a tumor-suppressive role of these miRNAs.
26043698 TAZ inhibits temozolomide induced apoptosis via upregulation of MCL-1 (myeloid cell leukemia 1) and high expression of TAZ predicts a poor prognosis for GBM patients
26036638 There was a negative correlation between the level of expression of miR-101 and MCL-1 in TNBC tissues.
26014377 Inhibition of Mcl-1 and activation of caspases are critically involved in gallotannin-induced apoptosis in prostate cancer cells.
25997995 Study revealed that Mcl-1 was the direct target of miR-193b. Its down regulation in hepatocellular carcinoma cells has a synergistic effect on cisplatin-induced apoptosis.
25950485 Authors recognize MCL-1 as the essential survival factor required for conservation of the postnatal PMF pool, growing follicle survival and effective oocyte mitochondrial function.
25922916 BCL2 and BCLX phosphorylation represents a priming event in mitotic cell death that is triggered by NOXA-dependent MCL1 degradation. The MCL1 decay allows in turn BIM-dependent cell death.
25918246 mTOR complex 2 regulates cell survival and growth in non-small-cell lung cancer (NSCLC) cell lines by stabilizing Mcl1.
25917317 MiR-205/miR-218 expression is associated with carboplatin chemoresistance and regulation of apoptosis via Mcl-1 and survivin signaling in lung cancer cells.
25909780 Crystallization of a maltose-binding protein MCL1 fusion has yielded a robust crystallography platform that generated the first apo MCL1 crystal structure, as well as five ligand-bound structures.
25882699 High MCL1 expression is associated with diffuse large B-cell lymphoma.
25873592 Data show that siRNA-mediated knockdown of myeloid cell leukemia sequence 1 (BCL2-related) protein (Mcl-1) enhanced the effects of BI-847325, whereas Mcl-1 overexpression reversed this in both 2D cell culture and 3D spheroid melanoma models.
25871384 Data demonstrate that soluble factors from MM cells are able to generate MDSC through Mcl-1 upregulation.
25844633 Mcl-1 binding is particularly perturbed by only four mutations of the 12 tested (V220A, N260A, R263A, and F319A), while Bcl-xL and Bcl-2 have a more diverse set of important residues depending on the bound helix.
25843953 FTY720 ehances TRAIL-induced apoptosis through up-regulation of DR5 and down-regulation of Mcl-1 in human kidney cancer cells.
25837021 a mechanism of inverse coregulation between BECN1 and MCL1 significantly contributes to their opposing roles in tumorigenesis
25789974 These results identify KLF4 and KLF5 as cooperating protumorigenic factors and critical participants in resistance to lapatinib, furthering the rationale for combining anti-MCL1/BCL-XL inhibitors with conventional HER2-targeted therapies.
25777305 Somatic mutations in MCL1 contribute to the pathogenesis of glioma by prolonging its half-life.
25756510 EGFR signaling defines Mcl1 survival dependency in neuroblastoma
25733019 Our data demonstrate that ES cells are uniquely sensitive to CDK1 inhibition via a p53/NOXA/MCL1 pathway.
25724519 miR-137/197 act as tumor suppressors in mediating apoptosis in multiple myeloma cells by targeting MCL-1.
25692226 These data support the use of MCL1 expression as a predictive biomarker for USP9X inhibitors in non-small cell lung cancer therapy
25674218 miR-29a is involved in the pathogenesis of ulcerative colitis by regulating intestinal epithelial apoptosis via Mcl-1.
25672320 Our study showed that Mcl-1 regulates the cell growth and might be a potential prognostic marker for gastric cancer
25647738 Results identified MCL-1 as a key molecule for acquiring epithelial-to-mesenchymal transition-associated chemo-resistance in human non-small cell lung cancer.
25641608 Report novel Mcl-1/Bcl-2 dual inhibitors that effectively induces apoptosis in a dose-dependent, mechanism-based manner in multiple cancer cell lines.
25627260 calcium signaling regulates Mcl-1 through translational events and a calmodulin-mediated pathway.
25596730 Suggest up-regulation of CDK9 kinase activity and Mcl-1 stability contributes to the acquired resistance to cyclin-dependent kinase inhibitors in leukemia.
25590803 A genetic approach, through siRNA-mediated down-regulation of AKT, MCL-1, and BCL-xL, significantly decreased cell survival, demonstrating the importance of these cell survival factors for ABT-199 resistance.
25505074 These findings show that MCL1 can shape the makeup of the CD8(+) T cell response, promoting the formation of long-term memory.
25499217 stroma-induced apoptosis resistance is mediated through signaling proteins that regulate transcriptional and translational expression and post-translational modification of Mcl-1 in CLL cells in context to bone marrow stromal microenvironment.
25486070 Mitochondria from Mcl-1-sensitive cells depend on Mcl-1 for their integrity and that antagonizing Mcl-1 function is sufficient to induce apoptosis.
25482013 Taken together, this study is the first to not only show that Mcl-1 is a novel target gene of FOXM1 but also suggest that targeting FOXM1/Mcl-1 may be a novel strategy to enhance sensitivity to oxaliplatin in gastric cancer.
25472497 Beclin 1 and Mcl-1 negatively modulate the proteasomal degradation of each other through competitive displacement of USP9X. Inverse co-regulation of Beclin 1 and Mcl-1 represents a mechanism of functional counteraction in cancer.
25456142 Upon mitochondrial depolarization, the Bcl-2 family member Mcl-1 underwent rapid Parkin- and PINK1-dependent polyubiquitination and degradation, which sensitized toward apoptosis via opening of the Bax/Bak channel.
25416050 MiR-363 downregulated the Mcl-1 expression in breast cancer cells.
25409302 Studies suggest that overexpression of Mcl-1L splice variant is associated with poor prognosis and chemoresistance in oral cancers.
25386925 MCL1 was frequently up-regulated in cervical cancer, and knockdown of MCL1 markedly inhibited cancer cell proliferation, migration and invasion, whereas ectopic expression of MCL1 significantly enhances these properties.
25376373 Hypoxia-induced p38 MAPK activation reduces Mcl-1 expression and facilitates sensitivity towards BH3 mimetics in chronic lymphocytic leukemia.
25375379 Cafestol overcomes ABT-737 resistance in Mcl-1-overexpressed renal carcinoma Caki cells through downregulation of Mcl-1 expression and upregulation of Bim expression.
25362855 Data indicate that myeloid cell leukemia sequence 1 (Mcl-1) and Aurora kinase A as potential treatment targets.
25343522 T. vaginalis induces mitochondria-dependent apoptosis in SiHa cells through the dissociation of Bcl-xL/Bim and Mcl-1/Bim complexes.
25341036 These data suggest that an interaction between Mcl-1 and VDAC promotes lung cancer cell migration by a mechanism that involves Ca(2+)-dependent reactive oxygen species production.
25340740 Tax interacted with and activated TRAF6, and triggered its mitochondrial localization, where it conjugated four carboxyl-terminal lysine residues of MCL-1 with lysine 63-linked polyubiquitin chains
25314294 MCL1 has lipid-dependent bimodal membrane activity.
25304383 Clitocine may activate Bak by disrupting the interaction between Mcl-1.
25296978 elevated expression is associated with inferior overall survival in multiple myeloma patients
25275312 IL-32 gamma added to human blood neutrophils in vitro is associated with sustained levels of MCL-1 protein. This effect in neutrophils corresponds to a decrease of MCL-1 protein degradation without any effect on MCL-1 mRNA levels.
25270224 Data indicate that Tanshinone IIA (Tan-IIA)T upregulated the protein expression of CHOP and Bax, but downregulated the protein expression of BiP, TCTP, Mcl-1 and Bcl-xL.
25231749 These results demonstrated that Gos induces apoptosis in MM cells not only through displacing BH3-only proteins from Bcl-2, but also through inhibiting IL-6 signaling, which leads to Bcl-2 dephosphorylation and Mcl-1 downregulation.
25210795 Mcl-1/Noxa axis is important to overcome resistance to mitochondrial apoptosis in squamous cell carcinoma.
25208882 Inhibition or overexpression of MCL-1 alone replicated the effects of LVshNG-1 or LVshNp8-1 in increasing or decreasing the apoptosis.
25196280 17-AAG downregulated (-)-gossypol-triggered Mcl-1 accumulation.
25194337 Data show that IL-27 on IFN-gamma mediated autophagy perpetuates by simultaneous induction of kinases mTOR via JAK/PI3 K/Akt cascade and increment in myeloid cell leukemia sequence 1 (Mcl-1) level through PI3 K pathway.
25107702 This study evaluated the role of MCL1 in the mechanism of drug resistance in cisplatin-resistant tumor cell lines.
25091479 By binding to p32, Mcl-1 can interfere with the uniporter function, thus inhibit the mitochondrial Ca(2+) uploading. This may provide a novel mechanism to explain the anti-apoptotic function of Mcl-1.
25084985 the simultaneous treatments for 24 h with quercetin plus ELF-MF increased Bcl-2 protein expression and prevented quercetin-induced downregulation of Mcl-1 and Bcl-xL.
25076060 Carboxylate-containing sulfide derivative 9 exhibited 16.4-fold more selectivity for disrupting Mcl-1/Bim over Bcl-xL/Bim binding.
25062042 We conclude that insulin and mTORC1 regulate cardiac miR-29-MCL-1 axis and its dysregulation caused by reduced insulin and mTORC1 inhibition increases the vulnerability of a diabetic heart to structural damage.
25043081 Compared with normal gallbladder tissues, FXR expression was decreased and MCL1 expression was increased in GBC, during progression of tumor node metastasis (TNM) stage
25024216 Potential pharmacological chaperones targeting cancer-associated MCL-1 and Parkinson disease-associated alpha-synuclein.
24999239 Study shows that Parkin-dependent mitophagy is antagonized by prosurvival members of the Bcl-2 family, Bcl-xL and Mcl-1 in a Beclin-1-independent manner.
24991768 Noxa upregulation reduces the availability of Usp9x to Mcl-1, thereby promoting its ubiquitination and degradation, leading to the apoptosis of neoplastic cells.
24969872 Including several anti-apoptotic Bcl-2 family members and c-Raf.
24947165 Up-regulation of Mcl-1 is associated with gastrointestinal stromal tumors.
24939844 Turnover via a phosphodegron-targeted pathway is reduced in Mcl-1-overexpressing BL41-3 Burkitt lymphoma cells.
24870742 MCL1 expression was higher in urothelial bladder cancer tissue than in adjacent normal tissue. MicroRNA29c induces apoptosis in bladder cancer cells by down-regulating MCL1.
24865469 Data show that interactions of Bim protein BH3 peptides to myeloid cell leukemia sequence 1 (Mcl-1) is stronger than the complex with bcl-2-associated X protein (Bax) 19BH3 peptides.
24852432 the expression-enhancing regulatory variants of MCL1 are protective modifiers of breast cancer risk.
24811167 these results suggest that the C-terminal tail of Noxa regulates the stability of both Noxa and Mcl-1.
24811082 High MCL1 expression is associated with drug resistance in glioma.
24789074 Data suggest that the structure of anti-apoptotic protein domain Mcl-1(171-327) is of critical importance to support future design of cancer drugs.
24769731 Ku70 is a novel Mcl-1 deubiquitinase that could be a potential target for cancer therapy by manipulating Mcl-1 deubiquitination.
24756163 In acute myeloid leukemia, data show that Mcl-1 expression is downregulated by direct binding of mir-181b to its 3'-untranslated region.
24742042 Triptolide has profound antitumor effect on CCA, probably by inducing apoptosis through inhibition of Mcl-1
24735609 Data indicate that Go6976 displays a significant antiproliferative activity against leukemia cells through the profound down-regulation of survivin and MCL-1.
24680709 Imperatorin is a Mcl-1 degradation inducer that can effectively suppress multidrug-resistant human liver cancer growth via Bax/Bak pathway.
24650799 PI3K/mTOR dual inhibitor NVP-BEZ235 decreases Mcl-1 expression and sensitizes ovarian carcinoma cells to Bcl-xL-targeting strategies, provided that Bim expression is induced.
24568469 High MCL1 expression is associated with decreased etoposide sensitivity in leukemia.
24564888 The WNT5B/MCL1 cascade is critical for regulation of triple negative breast cancer.
24556687 Demonstrate a prominent role for the spliceosome in mediating Mcl1 activity in neuroblastoma cells.
24556678 Thioridazine enhances TRAIL-mediated apoptosis in renal tumors via the ROS-mediated inhibition of Akt signaling and the downregulation of c-FLIP(L) and Mcl-1 at the post-translational level.
24529193 One of the mechanisms of Mcl-1 expression in esophageal squamous cell carcinoma cells is regulated by NF-kappaB.
24525728 Noxa recruits MCL-1 from the cytosol to the mitochondria modulating ABT-737 sensitivity in small cell lung cancer.
24481815 Association of MCL-1 with STAT3 modulates the normal, anti-apoptotic, activity of MCL-1, resulting in pro-apoptotic effects.
24469836 Results position TWEAK-Fn14 signaling through Mcl-1 as a significant mechanism for NSCLC tumor cell survival.
24369359 This is the first report of MCL1 and JUN coamplification in pseudomyxoma peritonei.
24280938 Downregulation of Mcl-1 has anti-inflammatory pro-resolution effects and enhances bacterial clearance from the lung.
24263101 pro-survival/anti-apoptotic signalling from S1P1 is intimately linked to its ability to promote the accumulation of pro-survival protein Mcl-1 and downregulation of pro-apoptotic BH3-only protein Bim via distinct signalling pathways.
24260268 MCL-1ES induces MCL-1L-dependent BAX- and BAK-independent mitochondrial apoptosis.
24234443 Nonphosphorylated HDAC1/2 is recruited to pre-mRNA by splicing factors to act at the RNA level with KAT2B and other lysine acetyltransferases to catalyze dynamic histone acetylation of the MCL1 alternative exon and alter the splicing of MCL1 pre-mRNA.
24213575 Increased leukocyte survival and accelerated onset of lymphoma in the absence of MCL-1 S159-phosphorylation.
24127964 Mcl-1 is expression positive both in cystic endometriotic lesions and endometrium; significantly lower in the cystic endometriotic lesions
24118207 BRAF signalling increases Mcl-1 expression in cutaneous metastatic melanoma
24113155 First evidence for a key role of the BOK-MCL1 system in regulating autophagy in the human placenta, whereby an adverse environment as seen in preeclampsia tilts the BOK-MCL1 balance toward the build-up of isoforms that triggers placental autophagy.
24091677 Knockdown of Cdc20 in HeLa cells stably overexpressing untagged wild-type Bcl-2, Bcl-xL or Mcl-1 promoted phosphorylation of the overexpressed proteins in parallel with their endogenous counterparts.
24040284 BAD dephosphorylation and decreased expression of MCL1 induce rapid apoptosis in prostate cancer cells.
24038028 Using gene reporter assays, we show that promoter variations in 11 intrinsic apoptosis genes, including ADPRT, APAF1, BCL2, BAD, BID, MCL1, BIRC4, BCL2L1, ENDOG, YWHAB, and YWHAQ, influence promoter activity in an allele-specific manner.
24025188 Triptolide mediated miR-204 increase causes pancreatic cancer cell death via loss of Mcl-1.
24019208 these promising findings show the therapeutic potential of Mcl-1 inhibitors against pancreatic cancer and warrant further preclinical investigations.
23991020 Data indicate that the signal of EIF5A2, MYCN, and MCL1 genes is decreased in hydroxyurea (HU) and gemcitabine (GEM) treated UACC-1598 ovarian cancer cell line.
23977882 Mcl-1 binds to the p53 DNA-binding domain weakly with a dissociation constant in the mM range. the p53 transactivation domain (TAD) binds strongly to Mcl-1 with a Kd ~ 10-20 muM
23954445 Mcl-1 knock-down resulted in marked cleavage of PARP and induction of apoptosis. Down-regulation of Bcl-2 or Bcl-xL had a much weaker effect.
23904379 Mcl-1 was a direct target of miR-106a.
23887890 Downregulation of the Notch pathway through gamma-secretase inhibitors (GSIs)involves an increase in protein levels of the anti-apoptotic Bcl-2 family members Mcl-1 and/or Bcl-xL which resulted in reduced Bax and Bak activation.
23883584 this study examined whether the inhibition of glucose metabolism using 2DG enhances sensitivity to afatinib in NSCLC cells with EGFR T790M through the regulation of the AMPK/mTOR/Mcl-1 signaling pathway
23872733 A novel Mcl1L variant efficiently protects tumor cells against extrinsic death signalling and therefore may provide a survival advantage for highly aggressive tumors.
23790646 This study demonistraed that Modulation of Mcl-1 expression reduces age-related cochlear degeneration.
23756231 the anti-tumor effect of miR-133a was probably due to targeting and repressing of Bcl-xL and Mcl-1 expression.
23750239 miR-26a impacts on cell proliferation and migration of breast cancer by regulating several carcinogenesis-related processes, including a novel mechanism involving the targeting of MCL-1
23711389 Data show that GALIG-induced cell death is counteracted by the overexpression of MCL-1, a pro-survival member of the Bcl2 family.
23696245 Upregulating Mcl-1 introduces multidrug resistance.
23681223 MCL-1 degradation freed the proapoptotic effectors BIM and BECN1 is leading to cell death-associated autophagy in fludarabine-sensitive cells.
23640248 Studied the possible role of miRNAs in the development of drug resistance in human lung cancer cell line and found that miR-135a/b were downregulated while MCL1 was upregulated in A549/CDDP (cisplatin) cells, compared with the parental A549 cells.
23636231 chrysin selectively decreases the levels of Mcl-1 protein, by downregulating Mcl-1 gene expression as determined by qRT-PCR.
23618862 Data show that YM155 induces apoptosis in leukemia cells through downregulation of survivin and Mcl-1, and that caspase-8 may play a critical role during apoptosis.
23611778 Data suggest that aspirin can be used to enhance Navitoclax-mediated anticancer activity via suppression of Mcl-1.
23608884 suggests that the p53/miR15a/16-1/Mcl-1 axis may be an important pathway that regulates Mcl-1 expression and contributes to drug resistance and aggressive phenotype in CLL cells with loss of p53
23580240 study demonstrates that Mcl-1 plays a key role in cellular survival in Mantle cell lymphoma and in cell death regulation by the PI3K/Akt/mTOR signaling pathway
23547049 CD44 promotes leukemogenesis by regulating stimuli of MCL1 expression.
23546867 miR-193a-3p induces apoptosis in cancer cells by directly targeting Mcl-1.
23524145 Celecoxib enhances the antitumor effect of photodynamic therapy through down-regulating Mcl-1.
23478333 The pro-cancer activity of Mcl1 requires elevated expression levels of the protein, the cancer genome adapts to ensure either high levels of synthesis or evasion of degradation.
23463670 sorafenib reduced the stability of the Mcl-1 protein by enhancing its ubiquitination and degradation by the proteasome via the AKT/GSK3beta and the ERK pathways.
23456625 TRAIL-induced activation of p38 and JNK have counteracting effects on Mcl-1 expression leading to pro- or anti-apoptotic effects, respectively.
23455323 The Mcl-1 promoter is dependent on a STAT consensus-site for B-RAF-mediated activation.
23431241 S. aureus is hijacking the Mcl-1-dependent inhibition of apoptosis to prevent the elimination of infected host cells, thus allowing the intracellular persistence of the pathogen.
23418490 betaArr1 and Mcl-1 are involved in the self-renewal and expansion of non-small cell lung carcinoma -cancer stem cells and are potential targets for anti-cancer therapy.
23369735 we describe that the specific knockdown of Bcl-xL, but not that of Bcl-2, Bcl-w or Mcl-1, renders cells sensitive to TNFalpha-induced apoptosis.
23364598 Activation of TREM-1 protected monocytic cells from apoptosis through activation of extracellular signal-regulated kinase and v-akt murine thymoma viral oncogene homologue pathways and MCL1
23341456 Studies indicate BAG3-mediated Mcl-1 stabilization as a potential target for cancer drug discovery.
23301543 A low Mcl-1 expression and Bim upregulation after antigen encounter are involved in CD127(low) HCV-specific cytotoxic T cell hyporeactivity during chronic infection.
23257783 MCL1 is deregulated in a significant fraction of ABC DLBCLs and contributes to therapy resistance. These data suggest that specific inhibition of MCL1 might be utilized therapeutically in a subset of DLBCLs
23195034 Flavones induce neutrophil apoptosis by down-regulation of Mcl-1 via a proteasomal-dependent pathway.
23174563 It possesses an ability to downregulate the antiapoptotic Mcl-1 protein.
23171055 Mcl-1, Bcl-xL and USP9X overexpression are tumor survival mechanisms protective against chemotherapy.
23158473 Ovarian cancer ascites increase Mcl-1 expression in tumor cells through ERK1/2-Elk-1 signaling to attenuate TRAIL-induced apoptosis.
23088735 The balance between Bax and Mcl-1 protein expression, and theinvolvement of p38MAPK and ERK1/2 signaling pathways in the control of Mcl-1 expression were investigated in obstructive sleep apnea patients undergoing nightly intermittent hypoxia episodes.
23064357 evidence that type 1 diabetes (DMT1) is response to viral infection: Data suggest that presence of immunoreactive enteroviral VP1 within pancreatic beta cells in DMT1 is associated with down-regulation of Mcl-1 (and induction of protein kinase R).
23059828 Mcl-1 does not have the major role in apoptosis triggered by protein synthesis inhibition.
23056582 Thr 163 phosphorylation causes Mcl-1 stabilization when degradation is independent of the adjacent GSK3-targeted phosphodegron, promoting drug resistance in cancer.
23024798 These data identify a new molecular determinant of Mcl-1 function, localization and stability that may be important for understanding the role of this protein in disease.
22994781 Oxaliplatin had the effect of down-regulating Mcl1 expression.
22934750 The multi-kinase inhibitor TG02 overcomes signalling activation by survival factors to deplete MCL1 and XIAP and induce cell death in primary acute myeloid leukaemia cells
22873792 Mcl-1L isoform has an important role in the survival and radioresistance of oral squamous carcinoma cells
22796578 Thrombomodulin upregulates extracellular signal-regulated kinase/myeloid leukemia cell-1 signaling to protect endothelial cells from calcineurin inhibitor-induced toxicity.
22686245 Unstimulated neutrophils from chronic obstructive pulmonary disease patients had significantly higher Mcl-1 mRNA expression.
22548841 Our results suggested that polymorphisms of NOXA and MCL1 may modify the risk of HPV16-associated oropharyngeal cancer.
22527182 These results suggest that Mcl-1 mediates the resistance to apoptosis in gastric cancer cells by blocking the mitochondrial pathway of cell death
22496479 study revealed a novel mechanism controlling MCL1 expression, in which Naa10p and RelA/p65 synergistically interact with MCL1 promoter region and promote MCL1 transcription
22456335 MCL1 expression levels inversely correlate with the responsiveness of gastric cancer cells toward HDACi.
22451485 Mcl-1 can inhibit chemotherapy-induced cell senescence CIS in both a p53-dependent and -independent manner in vitro and in vivo and that this Mcl-1-mediated inhibition can enhance tumor growth in vivo
22403404 resistance to Vpr-induced apoptosis is specifically mediated by cIAP1/2 genes independent of Bcl-xL and Mcl-1, which play a key role in maintaining cell viability.
22403404 HIV-1 PR is identified to have a physical interaction with myeloid cell leukemia sequence 1 (BCL2-related) (MCL1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22361683 NOXA, a sensor of proteasome integrity, is degraded by 26S proteasomes by an ubiquitin-independent pathway that is blocked by MCL-1.
22354970 p14(ARF)-induced apoptosis in p53 protein-deficient cells is mediated by BH3-only protein-independent derepression of Bak protein through down-regulation of Mcl-1 and Bcl-xL proteins
22311987 maritoclax represents a new class of Mcl-1 inhibitors, which antagonizes Mcl-1 and overcomes ABT-737 resistance by targeting Mcl-1 for degradation.
22292048 Inhibition of Mcl-1 and A1 strongly induced cell death in some melanoma cell lines.
22279045 Mcl-1 is critical for survival of human AML cells
22277751 our results indicate a novel role of Cav-1 in anoikis regulation through Mcl-1 interaction and stabilization
22270368 Depletion of Mcl-1 sensitized tumor cells to MEK inhibitor-induced cell death, an effect that was antagonized by knockdown of Bim.
22268450 Epstein-Barr virus latent membrane protein-1 protects B-cell lymphoma from rituximab-induced apoptosis through miR-155-mediated Akt activation and up-regulation of Mcl-1
22266706 SG511, a novel fiber chimeric oncolytic adenovirus, sensitizes cancer cells to cisplatin-induced apoptosis by reducing anti-apoptotic Mcl-1 protein levels.
22257632 These findings suggested the dysregulation of the apoptosis-related proteins MCL1 and BAK1 in multiple sclerosis.
22253918 An up-regulation at the transcriptional level of both pro-apoptotic Bak and pro-survival myeloid cell leukemia-1 (Mcl-1), is reported.
22231730 neutrophils from patients with sepsis express reduced levels of antiapoptotic Mcl1 and A1
22203987 Upregulation of myeloid cell leukemia protein-1 by human cytomegalovirus transiently protects nonpermissive myeloid cells from chemical and virus entry-induced cell death.
22194343 These data demonstrate that elevated myeloid cell leukemia sequence 1 levels are sufficient to confer apoptotic resistance on the human uterine myocyte despite highly elevated levels of active CASP3.
22190034 HIV-1 PR is identified to have a physical interaction with myeloid cell leukemia sequence 1 (BCL2-related) (MCL1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22188816 Findings suggest that sorafenib attenuates (-)-gossypol-induced Mcl-1 upregulation in androgen-independent prostate cancer cells (AI-PC) in cell death pathway that may depend on the level of Bak.
22125448 short-lived prosurvival Bcl-2 family protein, Mcl-1 (myeloid cell leukemia-1), is instrumental in controlling apoptosis and consequently neutrophil lifespan in response to rapidly changing environmental cues during inflammation
22108005 These results identify HMGB1-mediated upregulation of Mcl-1 transcription as an important mechanism by which autophagy protects gastric cancer cells from apoptosis.
22072062 Endoplasmic reticulum stress sensitizes cells to TRAIL through down-regulation of FLIP and Mcl-1 and PERK-dependent up-regulation of TRAIL-R2.
22056880 Bax and Bak are functionally redundant, but they are counteracted by distinct anti-apoptotic Bcl-2 family proteins in different species
22024133 Mcl-1 is complexed with Bak (but not Bax or Noxa) in untreated cells, and Bak becomes activated in concert with loss of Mcl-1 expression.
21993632 MiR-101 and Mcl-1 may play important roles as biomarkers for prognosis and therapeutic targets in non-small cell lung cancer
21951844 miRNA-29b downregulated the level of Mcl-1 without effect on the mRNA level.
21947543 The apoptosis process in human neutrophils exposed to NDMA is dependent on the intrinsic pathway mediated by Bax and Mcl-1 proteins.
21923740 Gaq controls the apoptosis of rheumatoid arthritis peripheral blood lymphocytes through regulating the activity of Mcl-1 and caspase-3.
21907705 Noxa triggers the degradation of Mcl-1 at the mitochondria according to the exclusive location of Noxa at this compartment.
21899728 breast cancer cells overexpressing HER2 undergo apoptosis upon depletion of Mcl-1, and this Mcl-1 dependence is due to their constitutive expression of the pro-apoptotic protein Bim
21896753 Data show that p53 directly up-regulates microRNA-149* (miR-149*) that in turn targets glycogen synthase kinase-3alpha, resulting in increased expression of Mcl-1 and resistance to apoptosis in melanoma cells.
21887682 common variants in MCL1 promoter correlated with increased transactivation in solid cancer cells and were associated with reduced risk of lung cancer in nonsmokers.
21863213 PUMA enhances sensitivity of SKOV3 cells to cisplatin by lowering the threshold set simultaneously by Bcl-x(L) and Mcl-1.
21846680 High Mcl-1 is associated with glioblastoma.
21841196 Mcl-1 is a determinant of cell fate, and ATF6 mediates apoptosis via specific suppression of Mcl-1 through up-regulation of WBP1
21824245 Taken together, these findings identify HIF-1alpha as responsible for upregulation of Mcl-1 and the maintenance of apoptosis resistance during Chlamydia infection.
21750559 Quercetin downregulates Mcl-1 acting directly or indirectly on its mRNA stability and protein degradation.
21734342 Mcl-1 serves as a predictive co-marker in tumors of the parotid gland.
21730980 findings suggest that reduced Mule/Mcl-1 complex has a significant role in increasing the stability of Mcl-1 in breast cancer cells and increased resistance to apoptosis
21674276 Our results suggest that Mcl-1 may play an important role in cervical cancer
21670080 In the presence of glucose, activated Akt prevented Loss of Mcl-1 expression & protected cells from growth factor deprivation-induced apoptosis. Mcl-1 associated with & inhibited the proapoptotic protein Bim, contributing to cell survival.
21659544 Distribution of Bim determines Mcl-1 dependence or codependence with Bcl-xL/Bcl-2 in Mcl-1-expressing myeloma cells.
21628457 Multiple BH3 mimetics antagonize antiapoptotic MCL1 protein by inducing the endoplasmic reticulum stress response and up-regulating BH3-only protein NOXA.
21613222 Mitochondrion-dependent N-terminal processing of outer membrane Mcl-1 protein removes an essential Mule/Lasu1 protein-binding site.
21596068 genetic knockdown of Mcl-1 resulted in marked induction of apoptosis in pancreatic cancer cell lines
21516346 Noxa/Mcl-1 balance is regulated by glucose deprivation as well as by general metabolic stress.
21504623 Findings indicate that HBx exerts pro-apoptotic effect upon exposure to oxidative stress probably through accelerating the loss of Mcl-1 protein via caspase-3 cascade
21471522 MiR-29a down-regulation in ALK-positive anaplastic large cell lymphomas contributes to apoptosis blockade through MCL-1 overexpression.
21423203 Mutations in the Ets-1 binding site or knockdown of Ets-1 inhibited the increase in Mcl-1, indicating that Ets-1 has a critical role in transcriptional upregulation of Mcl-1
21412051 MCL-1 regulates the balance between autophagy and apoptosis.
21406400 Data suggest that the joint overexpression of MCL1 and MYC may be a useful biomarker for both prognosis and treatment in NSCLC.
21393866 hypoxic tumor cell are sensitized to BH-3 mimetic-induced apoptosis via downregulation of the Bcl-2 protein Mcl-1
21368833 the E3 ubiquitin ligase SCF(FBW7) governs cellular apoptosis by targeting MCL1, a pro-survival BCL2 family member, for ubiquitylation and destruction in a manner that depends on phosphorylation by glycogen synthase kinase 3
21292770 Escape from p21-mediated oncogene-induced senescence leads to cell dedifferentiation and dependence on anti-apoptotic Bcl-xL and MCL1 proteins.
21258408 These results indicate that the EGF induced activation of Elk-1 is an important mediator of Mcl-1 expression and cell survival
21253591 Mcl-1 is both an upstream regulator and a downstream target of caspase activity in human neutrophils.
21247487 that Bim and Mcl-1 have key opposing roles in regulating JAK2V617F cell survival and propose that inactivation of aberrant JAK2 signaling leads to changes in Bim complexes that trigger cell death.
21228225 The authors demonstrate that HBx enhances cisplatin-induced hepatotoxicity by a mechanism involving degradation of Mcl-1, an antiapoptotic member of the Bcl-2 family.
21220745 the mechanism involved in c-Abl regulation of Mcl-1 expression in CLL cells
21216463 Data indicate that P276-00 rapidly and significantly down regulated both Cdk9 and Mcl-1 protein expression levels in a dose and time-dependent manner.
21151390 We report the correlation of Mcl-1 protein expression with higher grade and stage in colorectal cancer.
21148306 The BH3 alpha-helical mimic BH3-M6 disrupts Bcl-X(L), Bcl-2, and MCL-1 protein-protein interactions with Bax, Bak, Bad, or Bim and induces apoptosis in a Bax- and Bim-dependent manner.
21139567 MCL-1 is a stress sensor that regulates autophagy in a developmentally regulated manner.
21138867 Mcl-1 downregulation and Bax activation were also observed in xenografts.
21132008 results indicate that targeting Mcl-1 may improve therapy for a subset of NSCLC patients
21036904 Heterodimerization of BAK and MCL-1 activated by detergent micelles.
20802294 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20693279 Lyn-dependent regulation of miR181 is a novel mechanism of regulating Mcl-1 expression and cell survival.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20647761 The role for MCL-1 is in coordinating DNA damage mediated checkpoint response, and have broad implications for the importance of MCL-1 in maintenance of genome integrity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571074 Data show that loss of the antiapoptotic protein myeloid cell leukemia 1 (Mcl-1) coincided with mitotic cell death.
20526282 Data suggest that phosphorylation of Mcl-1 by CDK1-cyclin B1 and its APC/C(Cdc20)-mediated destruction initiates apoptosis if a cell fails to resolve mitosis.
20503275 BH3 mimetic S1 potently induces Bax/Bak-dependent apoptosis by targeting both Bcl-2 and Mcl-1
20501829 Overexpression of MCL1 is associated with prostate carcinogenesis.
20392693 analysis of selectivity of MCL-1 in binding BCL-2 homology 3 (BH3) ligands of interest for mammalian biology
20308427 The Mcl-1 rather than Bcl-xL is a major target for sensitization of Bax-deficient tumors for death receptor-induced apoptosis via the Bak pathway.
20197552 there was a dynamic increase MCL-1 transcript BFL-1 protein and transcript levels after ABT-737 treatment in resistant cells
20189983 Apoptosis protection by Mcl-1 and Bcl-2 modulation of inositol 1,4,5-trisphosphate receptor-dependent Ca2+ signaling.
20173022 Human cytomegalovirus engages the epidermal growth factor receptor to facilitate upregulation of Mcl-1 and acquisition of the apoptotic resistant phenotype in infected monocytes.
20156337 Glucocorticoid Response Elements (GREs) within the promoter regulatory regions of the Bcl-2 family members NOXA and Mcl-1 were identified, indicating that they are direct GR transcriptional targets.
20085644 Activation of VEGF165-NRP1-c-MET signaling could confer prostate cancer (PCa) cells survival advantages by up-regulating Mcl-1, contributing to PCa progression.
20066738 HPPCn is a novel hepatic growth factor that can be secreted to culture medium and suppresses apoptosis of hepatocellular carcinoma cells by up-regulating Mcl-1 expression.
20066663 the crystal structure of human Mcl-1 bound to a BH3 peptide derived from human Bim and the structures for three complexes that accommodate large physicochemical changes at conserved Bim sites was reported.
20051518 Data suggest that MCL1 steady-state expression levels do not affect sensitivity to proteasome-inhibitor treatment in neuronal tumor cells, and that both the repression of Bcl-xL and the activation of Noxa are necessary for bortezomib-induced cell death.
20038816 Sorafenib inhibits ERK1/2 and MCL-1(L) phosphorylation levels resulting in caspase 3-independent cell death in malignant pleural mesothelioma
20023629 the deubiquitinase USP9X stabilizes MCL1 and thereby promotes cell survival; deubiquitinases may stabilize labile oncoproteins in human malignancies
20004446 Mcl-1 downregulation could significantly enhance radiosensitivity of pancreatic carcinoma cells in vitro and in vivo.
19968986 Mcl-1(128-350) exerts a pro-apoptotic function governed by its capacity to interact with Bax.
19968719 STAT3 activation is associated with Mcl-1 expression in nasal NK-cell lymphoma
19968497 Observational study of gene-disease association. (HuGE Navigator)
19966861 Data show a novel mechanism for the sensitization to DR-induced apoptosis linking glucose metabolism to Mcl-1 downexpression, and provide a rationale for the combined use of DR ligands with AMPK activators or mTOR inhibitors in the treatment of cancers.
19965632 Data show that down-regulation of MCL-1 in prednisolone-resistant MLL-rearranged leukemia cells by RNA interference, to some extent, led to prednisolone sensitization.
19955184 Data suggest that F1L replaces the antiapoptotic activity of Mcl-1 during vaccinia virus infection by interacting with Bak using highly divergent BH domains.
19949310 CDODO-Me-12 and CDODO-Me-11 downregulated the levels of anti-apoptosis protein Mcl-1 in HL-60, U937 and K562 leukemic cell lines.
19942343 Triptolide induced abundant apoptosis with a prominent decline of Bcl-2, Bcl-X(L), survivin and Mcl-1 in myeloproliferative disorder cells.
19933775 The expression of Mcl-1 was significantly reduced when COX-2 was suppressed and knockdown of Mcl-1 substantially sensitized tumor cells to apoptosis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19887550 In the HA14-1 nonresponsive cell lines (SKOV3 and OAW42), small interfering RNA-mediated Mcl-1 downregulation allowed HA14-1-induced massive apoptosis in the absence of chemotherapy.
19841168 these data demonstrate for the first time that the intrinsic apoptosis pathway in neutrophils from severely injured patients is blocked at least in part by elevated Mcl-1 levels induced by GM-CSF.
19840460 2-methoxyestradiol can regulate the apoptosis of myelodysplastic syndrome cells through down-regulating the expression of mcl-1 mRNA and activating caspase-3.
19838163 Correlation of LDH-5 expression with clinicopathological factors and with the expression of Bcl-2, Bcl-XL, Mcl-1 and GRP78 was examined in pigmented lesions, including nevi and melanoma at different stages of progression
19808698 the acquisition of FLT3-internal tandem duplications ensures leukemic stem cells survival by up-regulating MCL-1 via constitutive STAT5 activation that is independent of wild-type FLT3 signaling.
19782681 immediate impact of Mcl-1 protein level manipulations on the course of early acute apoptotic response of colon adenocarcinoma cells to TRAIL.
19773546 Bim, and Mcl-1, but not Bad, integrate death signaling triggered by concomitant disruption of the PI3K/Akt and MEK1/2/ERK1/2 pathways in human leukemia cells.
19763916 Increased expression of Mcl-1 protein was observed in 26% of NSCLC cases with EGFR overexpression.
19748896 Mcl-1 binds with high affinity to peptides resembling natural BH3 domain sequences.
19737931 Interference with Puma induction or expression of MCL1 or BCL2 significantly reduced both glucocorticoid- and FAS-induced cell death in p16INK4A-reconstituted leukemia cells.
19734538 PKC-dependent destabilization of Mcl-1 is a mechanism contributing to hepatocyte lipoapoptosis
19684859 findings suggest that the combination of ABT-737 and Mcl-1 knockdown represents a promising, new treatment strategy for malignant melanoma
19683529 Data show that MCL-1ES interacts with MCL-1L and induces mitochondrial cell death, suggesting that alternative splicing of MCL-1 may control the fate of cells.
19676043 Microrna can inhibit MCL1 expression and may induce apoptosis in a glioblbastoma cell line.
19654003 over-expression of miR-133B increased apoptosis in response to gemcitabine and reduced MCL-1 and BCL2L2 expression.
19634140 MCL-1 targeted strategies could constitute an efficient therapeutic tool for the treatment of chemoresistant ovarian carcinoma, in association with conventional chemotherapy.
19616548 Data show that eosinophils treated with R-roscovitine lose mitochondrial membrane potential and the key survival protein Mcl-1 is down-regulated.
19605477 hepatitis C virus core protein contains a BH3 domain that regulates apoptosis through specific interaction with human Mcl-1
19587033 Inhibition of host gene expression by the VSV M protein resulted in the degradation of Mcl-1 but not Bcl-X(L); inactivation of both Mcl-1 and Bcl-X(L) was required for cells to undergo apoptosis
19582795 Mcl-1 is highly upregulated in gastric cancer and high Mcl-1 expression is correlated with a poor prognosis in gastric cancer patients.
19581935 functional and biochemical evidence that Syk regulated chronic lymphocytic leukemia B cell survival through a novel pathway involving PKCdelta and a proteasome-dependent regulation of the anti-apoptotic protein Mcl-1
19571464 These results imply a potentially important and novel role of the inhibition of Mcl-1 function
19549371 As(2)O(3) can markedly decrease mitochondrial respiratory function and membrane potential of Raji cells, and down-regulate expression of mcl-1 gene.
19523441 EG-VEGF protects pancreatic cancer cells from apoptosis through upregulation of myeloid cell leukemia-1, an anti-apoptotic protein of the bcl-2 family.
19503096 Chromatin remodeling at Alu repeats by epigenetic treatment activates silenced microRNA-512-5p with downregulation of Mcl-1 in human gastric cancer cells. (microRNA-512-5p)
19484260 Late tumour stages of Kaposi sarcoma in tissues from HIV-positive patients are associated with high levels of LANA-1, HIF-1alpha and of the anti-apoptotic proteins, Bcl-2 and Mcl-1.
19481066 Bz-423 superoxide signals B cell apoptosis via MCL1, BAK, and BAX.
19401626 Down-regulation of Mcl-1L in clear-cell renal cell carcinomas is associated with shortened recurrence-free and disease-specific survival.
19372583 Enhanced Mcl-1 expression is associated with melanoma.
19369967 Modification of alternative splicing of Mcl-1 pre-mRNA using antisense morpholino oligonucleotides induces apoptosis in basal cell carcinoma cells.
19288493 Role of RAF/MEK/ERK pathway, p-STAT-3 and Mcl-1 in sorafenib activity in human pancreatic cancer cell lines.
19285955 This study demonstrated the physical association of the MCL-1 and IEX-1 proteins, the modulatory role of MCL-1 in IEX-1-induced apoptosis, and the role of BIM as an essential downstream molecule for IEX-1-induced cell death.
19148187 The results demonstrate that loss of Mcl-1 is a critical heat-sensitive step leading to Bax activation that is controlled by Hsp70.
19099185 review summarizes the current knowledge on the regulation of Mcl-1 expression and discusses the alternative approaches targeting Mcl-1 in human cancer cells
19092849 inhibition of syk prevented the increase in leukemic cell viability induced by sustained BCR engagement and inhibited BCR-induced Akt activation and Mcl-1 upregulation
19077158 MCL1 mRNA expression in myeloma cells was upregulated;but lacked association with overall and event-free survival.
19051025 Increased Mcl-1 expression plays a role in hepatoprotection upon cholestatic liver injury.
19037233 Mcl-1 acts as a major survival protein by inhibiting premature apoptosis in the spinous and granular layers to promote conification, and promotes the robust induction of keratinocyte differentiation markers
19012245 multiple copy number alterations in chromosome regions implicated in malignancy progression and indicated a strong expression of MAP2K4 and MCL1 genes in rhabdomyosarcoma
19008456 Mcl-1 expression may therefore be useful in predicting poor response to chemoimmunotherapy.
18769617 Mcl-1 up-regulation is primarily required to maintain apoptosis resistance in C. trachomatis-infected cells
18768389 IL-3 up-regulates the expression of the antiapoptotic proteins cIAP2, Mcl-1, and Bcl-X(L) and induces a rapid and sustained de novo expression of the serine/threonine kinase Pim1 that closely correlates with cytokine-enhanced survival.
18757878 Mutations also dramatically decrease the levels of MLC1 in cells from megalencephalic leukoencephalopathy with subcortical cysts patients.
18676833 Erk could phosphorylate Mcl-1 at two consensus residues, Thr 92 and 163, which is required for the association of Mcl-1 and Pin1, resulting in stabilization of Mcl-1
18676738 HPV 16/18 up-regulates the expression of interleukin-6 and antiapoptotic Mcl-1 in non-small cell lung cancer
18647593 These findings suggest that calpain inhibition delays neutrophil apoptosis via cyclic AMP-independent activation of PKA and PKA-mediated stabilization of Mcl-1 and XIAP.
18609706 Bcl-x(L) and, to a lower extent, Mcl-1, are important anti-apoptotic factors in colorectal carcinoma.
18599795 The close correlation between Mcl-1 expression and V(H) gene mutation status, CD38 expression, and ZAP-70 expression offers a biologic explanation for their association with adverse prognosis in CLL.
18552129 MCL-1 expression is activated by Triiodothyronine, which increases its promoter activity by a non-genomic mechanism using the PI3-K signal transduction pathway.
18543107 Inhibition of the proteasome by cobalt chloride leads to the accumulation of Mcl-1 which acts to limit cobalt chloride induced apoptosis.
18495871 Mcl-1, perhaps acting as an adaptor protein, in controlling the ATR-mediated regulation of Chk1 phosphorylation
18483275 deregulated PKB/AKT stabilizes Mcl-1 expression in a mammalian target of rapamycin (mTOR)-dependent pathway
18452656 Polymorphisms in MCL1 might be one of genetic factors for the risk of clinical tuberculosis development.
18452656 Observational study of gene-disease association. (HuGE Navigator)
18415656 Anti-myeloma effect of homoharringtonine with concomitant targeting of the myeloma-promoting molecules, Mcl-1, XIAP, and beta-catenin
18292181 Demonstrate that CUGBP2 inhibits Mcl-1 expression by inhibiting Mcl-1 mRNA translation, resulting in driving the cells to apoptosis during the G(2) phase of the cell cycle.
18234961 This study identifies mitogen-activated protein kinase/ERK/Mcl-1 as an important survival signaling pathway in the resistance of melanoma cells to Fas-mediated apoptosis.
18208354 Transcription regulation assays with MCL-1 promoter deletion mutants showed that most of the p53 inhibitory effect was mediated by the -41 to +16 bp promoter binding sites only for TATA-binding protein and other basal transcription factors.
18178565 distinctions in the behaviors of Bcl-B and Mcl-1 relative to the other anti-apoptotic Bcl-2 family members, where Bcl-B and Mcl-1 display reciprocal abilities to bind and neutralize Bax and Bak.
18089567 the pro-survival activity of MCL-1 proceeds via inhibition of BAX function at mitochondria, downstream of its activation and translocation to this organelle.
18088462 STI571 induces the apoptosis of K562 cells by down-regulating the expressions of Mcl-1 and Bcl-xl.
18046444 High MCL-1 expression is associated with B-cell chronic lymphocytic leukemia
18032706 findings not only illustrate MCL1 as an aberrantly expressed reprogramming oncoprotein in follicular lymphomas but also highlight MCL1 as key therapeutic target
18025305 MCL1 determines the Bax dependency of Nbk/Bik-induced apoptosis.
18006817 Mcl-1 degradation primes the cell for Bim and Bax activation and anoikis, which can be blocked by oncogenic signaling in metastatic cells
17942758 While TNFalpha had no effect on MCL-1 transcription, it induced expression of another antiapoptotic molecule, BFL-1.
17928528 Akt and Mcl-1 are major components of a survival pathway that can be activated in CLL B cells by antigen stimulation.
17907802 HIV-1 PR is identified to have a physical interaction with myeloid cell leukemia sequence 1 (BCL2-related) (MCL1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17893147 a caspase-9 signaling cascade induces feedback disruption of the mitochondrion through cleavage of anti-apoptotic Bcl-2, Bcl-xL, and Mcl-1
17823113 These results suggest that the N terminus of MCL-1 plays a major regulatory role, regulating coordinately the mitochondrial (anti-apoptotic) and nuclear (anti-proliferative) functions of MCL-1.
17805325 Mcl-1(139) is an HLA-A2-restricted epitope from Mcl-1 recognized spontaneously by cytotoxic T cells in cancer patients.
17698840 Mcl-1 confers TRAIL resistance by serving as a buffer for Bak, Bim, and Puma, and sorafenib is a potential modulator of TRAIL sensitivity
17599053 BCR/ABL induces SPK1 expression and increases its cellular activity, leading to upregulation of Mcl-1 in CML cells.
17561513 The degradation versus stabilized expression of antiapoptotic MCL1 is thus controlled by N-terminal truncation as well as by ERK- and GSK3 (but not G2/M)-induced phosphorylation
17553788 stress-induced phosphorylation of eIF2 alpha is directly coupled to mitochondrial apoptosis regulation via translational repression of MCL-1
17545167 tribbles homolog 2-Mcl-1 axis plays an important role in survival factor withdrawal-induced apoptosis of TF-1 erythroleukemia cells.
17525735 preformed Bim(EL)/Mcl-1 and Bim(EL)/Bcl-x(L) complexes can be rapidly dissociated following activation of ERK1/2 by survival factors
17498302 Both ionizing radiation and daunorubicin treatment resulted in concerted protein modulations of Mcl-1, Hdm2 and Flt3.
17495975 EXEL-0862 induced apoptotic death in EOL-1 cells and imatinib-resistant T674I FIP1L1-PDGFR-alpha-expressing cells, and resulted in significant downregulation of the antiapoptotic protein Mcl-1 through a caspase-3 dependent mechanism.
17463001 the antiapoptotic function of Mcl-1 is enhanced by serine 64 phosphorylation
17387146 Results indicate that the turnover of Mcl-1 by beta-TrCP is an essential mechanism for GSK-3beta-induced apoptosis and contributes to GSK-3beta-mediated tumor suppression and chemosensitization.
17384650 This study is the first to show a clear dissociation between changes in Bcl-2 expression (downregulation) and Bcl-XL, Mcl-1 expression (upregulation) during progression of melanoma.
17227835 GX15-070 induced apoptosis in vitro in MCL cell lines and primary cells from patients with MCL by releasing Bak from Mcl-1 and Bcl-X(L).
17200126 Because of its rapid turnover, Mcl-1 may serve as a convergence point for signals that affect global translation, coupling translation to cell survival and the apoptotic machinery
17145774 These results demonstrate that anoxia-induced cell death requires the loss of Mcl-1 protein and inhibition of the electron transport chain to negate Bcl-X(L)/Bcl-2 proteins.
17072336 Specific knockdown of Mcl-1 gene expression by small interfering RNA yielded an increase in apoptosis of LNCaP-IL-6+ cells.
17009247 The expression of Mcl-1 was suppressed with small interfering RNA (siRNA) or chemical inhibitors of the phosphatidylinositol 3-kinase (PI 3-kinase)/Akt-1 and signal transducer and activator of transcription 3 (STAT-3) pathways.
16978419 Mycobacterium leprae inhibits apoptosis in THP-1 cells by upregulation of Mcl-1 gene expression and downregulation of Bad and Bak .
16969094 Mcl-1 is a promising molecular target for antisense oligonucleotide-based treatment strategies for gastric cancer in the future.
16901898 Overexpression of Mcl-1 protects HaCaT cells from both ultraviolet and protein kinase C delta-catalytic fragment-induced apoptosis and blocks release of cytochrome c from the mitochondria.
16822835 The internal EELD domain facilitates mitochondrial targeting of Mcl-1 via a Tom70-dependent pathway.
16782027 Noxa/Mcl-1 axis is an apoptosis rheostat in dividing cells, in a selective pathway that functions to restrain lymphocyte expansion and can be triggered by glucose deprivation
16761109 MCL1 was upregulated by PMA in THP-1 & U937 myeloid leukemia cells, but by microtubule disrupting agents only in THP-1 cells.
16725198 This signalling cascade results in viability in a group of patients in which observe an increase of Mcl-1 expression levels after CD5 stimulation in B-CLL patients.
16543145 The results demonstrate that the control of MCL-1 stability by GSK-3 is an important mechanism for the regulation of apoptosis by growth factors, PI3K, and AKT.
16538501 Analysis of B-cell chronic leukemia cells for ZAP 70 expression and the expression of cyclin E, bcl-2, bax, and mcl-1.
16478725 Mcl-1 may serve as a direct substrate for TRAIL-activated caspases implying the existence of a novel TRAIL/caspase-8/Mcl-1/Bim communication mechanism between the extrinsic and the intrinsic apoptotic pathways
16456709 REVIEW: Mcl-1 plays an apical role in many cell death and survival regulatory programs.
16380381 Data demonstrate a novel regulation of tBid by Mcl-1 through protein-protein interaction in apoptotic signaling from death receptors to mitochondria.
16339575 Mcl-1 was critical for the survival of RA synovial fibroblasts, because the forced reduction of Mcl-1 using a Mcl-1 antisense-expressing adenoviral vector induced apoptotic cell death, which was mediated through Bax, Bak, and Bim
16327976 Mcl-1 is an important factor for the apoptosis resistance of human HCC, and constitutes an interesting target for HCC therapy
16289418 Mcl-1 is overexpressed in half of HCC-tissues. ASO targeting Mcl-1 revealed a prominent single agent and chemosensitizing activity against HCC in vitro.
16229017 Knockdown of HIF-1alpha induced parallel knockdown of Mcl-1 mRNA and protein expression, whereas Mcl-1 knockdown had no noticeable effect on HIF-1alpha expression. Both of these proteins were shown to be anti-apoptotic.
16213503 The unliganded form of Mcl-1 is sensitive to LASU1-mediated degradation of Mcl-1.
16109713 Mcl-1 is downregulated via inhibition of translation after administration of BAY 43-9006 in human leukemia cells
16091744 Melphalan-induced apoptosis in multiple myeloma is associated with a cleavage of MCL1 and BIM and a decrease in the MCL1/BIM complex.
16027162 The anti-apoptotic poein MCL1 inhibits mitochondrial Ca2+ signals.
16007132 The interaction of PUMA with MCL1 is not sufficient to prevent the rapid degradation of MCL1.
15989957 Mule (Mcl-1 ubiquitin ligase E3)is both required and sufficient for the polyubiquitination of Mcl-1
15940637 autocrine IL-6/Akt signaling pathway enhances Mcl-1 expression in cholangiocarcinoma
15902294 The Mcl-1, which has been shown to be essential for the survival of human myeloma cells in vitro, is overexpressed in vivo in MM in relation with relapse and shorter survival. Mcl-1 represents a potential therapeutical target in multiple myeloma.
15901672 role in sequestering proapoptotic Bak
15842635 Overexpression of anti-apoptotic Mcl-1 may function to enhance the viability of testicular germ cells, thereby leading to tumorigenesis.
15753661 Mcl-1 protein is overexpressed in a subset of human NSCLC and enhanced levels of Mcl-1 may protect lung cancer cells from death induced by a variety of pro-apoptotic stimuli.
15728130 Mcl-1 is induced by signaling through the B-cell receptor, which promotes survival of chronic lymphocytic leukemia B cells
15713684 Knockdown results in a significant level of apoptosis in the absence of external apoptotic stimulation
15637055 removal of N-terminal domains of Bid by caspase-8 and Mcl-1 by caspase-3 enables the maximal mitochondrial perturbation that potentiates TRAIL-induced apoptosis
15626746 MCL-1 is a BCR/ABL-dependent survival factor and interesting target in chronic myeloid leukemia.
15613543 Mcl-1 accumulation is an unwanted molecular consequence of exposure to proteasome inhibitors, which slows down their proapoptotic effects
15611089 Overexpression of Mcl-1 protected hepatoma cells against apoptosis induced by tert-butyl hydroperoxide.
15588513 SDF-1/CXCL12 enhanced cell survival in synergy with other cytokines involves activation of CREB and induction of Mcl-1 and c-Fos
15550399 Mcl-1 solution structure and analysis of binding by proapoptotic BH3-only ligands
15378010 Cleavage of Mcl-1 by caspases modifies its subcellular localization, increases its association with Bim and inhibits its antiapoptotic function.
15370246 drug sensitivities of CLL leukemic cells correlated inversely with Mcl-1 levels; results suggest that Mcl-1 may contribute to cell survival in CLL; an inverse correlation was found between Mcl-1 expression and Rai stage
15262975 the fortilin-MCL1 interaction increases cellular resistance to apoptosis by allowing MCL1, an independently antiapoptotic protein, to stabilize another independently antiapoptotic protein, fortilin
15241487 MCL1 is subject to multiple, separate, post-translational phosphorylation events, produced in living versus dying cells at ERK-inducible versus ERK-independent sites
15217829 VEGF-induced MM cell proliferation and survival are mediated via Mcl-1; VEGF up-regulates Mcl-1 expression in a time- and dose-dependent manner in 3 human MM cell lines and MM patient cells
15126604 The MCL-1 promoter insertion may identify a high-risk group of CD38-negative CLL patients
15122313 Mcl-1 function is an effective means of inducing apoptosis in Mcl-1-positive B-cell lymphoma.
15078892 Profound changes in the rate of neutrophil apoptosis following Granulocyte macrophage colony-stimulating factor signaling occur via dynamic changes in the rate of Mcl-1 turnover via the proteasome.
15077116 These results are consistent with a model in which p53 and Mcl1 have opposing effects on mitochondrial apoptosis by interacting with, and modulating the activity of, the death effector Bak.
15014070 Mcl-1L degradation by either GrB or caspase-3 interferes with Bim sequestration by Mcl-1L
14982947 IL-15 does not increase IL-1alpha or IL-1beta production but induces IL-1Ra release, increases myeloid cell differentiation factor-1 stability, decreases the activity of caspase-3 and caspase-8, resulting in an inhibition of vimentin cleavage
14633975 restoration of MCL-1 expression rescued infected cells from E1A-induced apoptosis
12960271 fMLP-stimulated neutrophils coordinate the regulation of FOXO transcription factors and the survival factor Mcl-1, a mechanism that may allow neutrophils to alter their survival.
12915532 Respiratory syncytial virus mediated the strong induction of antiapoptotic factors of the Bcl-2 family, especially Mcl-1, which might account for the delayed induction of apoptosis in RSV-infected cells.
12901848 data suggest a role for Mcl-1 in protecting endothelial cells against Stx-1-induced apoptosis
12855556 protein geranylgeranylation is critical for regulating myeloma tumor cell survival, possibly through regulating Mcl-1 expression
12787138 Mcl-1 is an important factor contributing to the chemoresistance of human melanoma in vivo.
12783855 Following UV treatment, Mcl-1 protein synthesis is blocked, the existing pool of Mcl-1 protein is rapidly degraded by the proteasome, and cytosolic Bcl-xL translocates to the mitochondria
12782407 the human EAT gene driven by the EF1 alpha promoter induced hyperplasia of Langerhans islet cells and upregulation of Bax and Bag-1 -- possible heterodimeric partners for EAT in the anti-apoptotic process
12660820 mechanisms regulating Mcl-1 levels in MM cells are heterogeneous, and are often independent from IL-6 signaling pathways
12637318 activation of STAT3 was dependent on Ser727 phosphorylation, in the absence of detectable Tyr705 phosphorylation; expression of human STAT3 in murine macrophages rescued inhibition of human Mcl-1 promoter gene activation and cell death induced by NaSal
12496428 The antiapoptotic effect of the in vitro induction of MCL1 expression in Mycobacterium tuberculosis strain H37Rv-infected macrophages promotes the intracellular survival and proliferation of virulent M. tuberculosis.
12475993 interaction of Mcl-1 with tankyrase 1 leads to the modulation of the apoptosis pathway
12445202 in basal cell carcinoma cells, the upregulation of the anti-apoptotic Mcl-1 protein by interleukin-6 is mainly through the Janus tyrosine kinase/phosphotidyl inositol 3-kinase/Akt, but not the STAT3 pathway.
12359245 related to ratio of p21(WAF)/cyclin A and Jun kinase phosphorylation to apoptosis in human breast carcinomas
12223490 inactivation of Mcl-1 by JNK-dependent phosphorylation may be one of the mechanisms through which oxidative stress induces cellular damage in human cells
12176902 follicular dendritic cells protect CLL B cells against apoptosis, at least in part through a CD44-dependent mechanism involving up-regulation of Mcl-1
12070027 Antisense strategy shows that Mcl-1 rather than Bcl-2 or Bcl-x(L) is an essential survival protein of human myeloma cells.
12057933 Mcl-1 is over epxressed in anaplastic large cell lymphoma cell lines and tumors.
11911971 Expression of apoptotic regulators and their significance in cervical cancer
11877256 Myeloid cell factor-1 (Mcl-1)is a critical survival factor for multiple myeloma.
11781193 expression in normal, hyperplastic and carcinomatous human prostate

AA Sequence

MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLT      1 - 70
PDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAV     71 - 140
LPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKAL    141 - 210
ETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKT    211 - 280
INQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR    281 - 350
//

Text Mined References (479)

PMID Year Title
27455555 2016 Knockdown of the FoxM1 enhances the sensitivity of gastric cancer cells to cisplatin by targeting Mcl-1.
27063186 2016 miR-29b and miR-198 overexpression in CD8+ T cells of renal cell carcinoma patients down-modulates JAK3 and MCL-1 leading to immune dysfunction.
27049076 Silencing of myeloid cell leukemia-1 by small interfering RNA improves chemosensitivity to etoposide in u-937 leukemic cells.
27013495 2016 The deubiquitinase Usp27x stabilizes the BH3-only protein Bim and enhances apoptosis.
26921175 2016 Mcl-1 confers protection of Her2-positive breast cancer cells to hypoxia: therapeutic implications.
26859456 2016 Exploitation of the Apoptosis-Primed State of MYCN-Amplified Neuroblastoma to Develop a Potent and Specific Targeted Therapy Combination.
26739047 2016 Human Cytomegalovirus Stimulates the Synthesis of Select Akt-Dependent Antiapoptotic Proteins during Viral Entry To Promote Survival of Infected Monocytes.
26720004 2015 Bay 61-3606 Sensitizes TRAIL-Induced Apoptosis by Downregulating Mcl-1 in Breast Cancer Cells.
26718267 2016 MicroRNA-101 sensitizes hepatocellular carcinoma cells to doxorubicin-induced apoptosis via targeting Mcl-1.
26636651 2015 Metastasis-associated MCL1 and P16 copy number alterations dictate resistance to vemurafenib in a BRAFV600E patient-derived papillary thyroid carcinoma preclinical model.
26610208 2015 In non-transformed cells Bak activates upon loss of anti-apoptotic Bcl-XL and Mcl-1 but in the absence of active BH3-only proteins.
26540567 2015 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3K? or PKC? signaling pathways.
26538029 2016 Mcl-1 involvement in mitochondrial dynamics is associated with apoptotic cell death.
26526790 2015 miR-193b Modulates Resistance to Doxorubicin in Human Breast Cancer Cells by Downregulating MCL-1.
26522352 2015 [The myeloid cell leukemia-1 mRNA splicing mediated by epithelial splicing regulatory protein 1 (ESRP1) in glioma U251 cell lines].
26504803 2015 miR-125b Suppresses Proliferation and Invasion by Targeting MCL1 in Gastric Cancer.
26497853 2015 Overexpression of Mcl-1 confers resistance to BRAFV600E inhibitors alone and in combination with MEK1/2 inhibitors in melanoma.
26452980 2015 Co-administration of the mTORC1/TORC2 inhibitor INK128 and the Bcl-2/Bcl-xL antagonist ABT-737 kills human myeloid leukemia cells through Mcl-1 down-regulation and AKT inactivation.
26384220 2016 Glucocorticoid-Induced Leucine Zipper Is Expressed in Human Neutrophils and Promotes Apoptosis through Mcl-1 Down-Regulation.
26323360 2015 17-Demethoxy-reblastatin, an Hsp90 inhibitor, induces mitochondria-mediated apoptosis through downregulation of Mcl-1 in human hepatocellular carcinoma cells.
26314849 2015 A novel small-molecule IAP antagonist, AZD5582, draws Mcl-1 down-regulation for induction of apoptosis through targeting of cIAP1 and XIAP in human pancreatic cancer.
26297542 2015 miR-125a-5p inhibits cell proliferation and induces apoptosis in colon cancer via targeting BCL2, BCL2L12 and MCL1.
26296968 2015 Leukemia inhibitory factor protects cholangiocarcinoma cells from drug-induced apoptosis via a PI3K/AKT-dependent Mcl-1 activation.
26258756 2015 Reduced miR-512 and the Elevated Expression of Its Targets cFLIP and MCL1 Localize to Neurons With Hyperphosphorylated Tau Protein in Alzheimer Disease.
26219338 2015 Cyclin E/Cdk2-dependent phosphorylation of Mcl-1 determines its stability and cellular sensitivity to BH3 mimetics.
26205817 2015 Structure-Function Analysis of the Mcl-1 Protein Identifies a Novel Senescence-regulating Domain.
26184999 2015 Tyrosine kinase inhibitor tyrphostin AG490 triggers both apoptosis and autophagy by reducing HSF1 and Mcl-1 in PEL cells.
26143754 2015 Downregulation of miR-363 increases drug resistance in cisplatin-treated HepG2 by dysregulating Mcl-1.
26097563 2015 Combinatorial effects of miR-20a and miR-29b on neuronal apoptosis induced by spinal cord injury.
26096930 2016 Resistance to HSP90 inhibition involving loss of MCL1 addiction.
26078955 2015 Mcl-1 Is a Novel Target of miR-26b That Is Associated with the Apoptosis Induced by TRAIL in HCC Cells.
26068790 2015 Early downregulation of Mcl-1 regulates apoptosis triggered by cardiac glycoside UNBS1450.
26063499 2015 Lipoic acid decreases Mcl-1, Bcl-xL and up regulates Bim on ovarian carcinoma cells leading to cell death.
26058661 2015 Myeloid cell leukemia-1 promotes epithelial-mesenchymal transition of human gastric cancer cells.
26056043 2015 Metformin combined with aspirin significantly inhibit pancreatic cancer cell growth in vitro and in vivo by suppressing anti-apoptotic proteins Mcl-1 and Bcl-2.
26052614 2015 miR-22 and miR-29a Are Members of the Androgen Receptor Cistrome Modulating LAMC1 and Mcl-1 in Prostate Cancer.
26043698 2015 TAZ promotes temozolomide resistance by upregulating MCL-1 in human glioma cells.
26036638 2015 MicroRNA-101 inhibits cell progression and increases paclitaxel sensitivity by suppressing MCL-1 expression in human triple-negative breast cancer.
26014377 2015 Inhibition of Myeloid Cell Leukemia 1 and Activation of Caspases Are Critically Involved in Gallotannin-induced Apoptosis in Prostate Cancer Cells.
25997995 2015 miR-193b acts as a cisplatin sensitizer via the caspase-3-dependent pathway in HCC chemotherapy.
25950485 2015 Mcl-1 is a key regulator of the ovarian reserve.
25922916 2015 The NOXA-MCL1-BIM axis defines lifespan on extended mitotic arrest.
25918246 2015 mTOR Complex 2 Stabilizes Mcl-1 Protein by Suppressing Its Glycogen Synthase Kinase 3-Dependent and SCF-FBXW7-Mediated Degradation.
25917317 2015 MiR-205 and miR-218 expression is associated with carboplatin chemoresistance and regulation of apoptosis via Mcl-1 and Survivin in lung cancer cells.
25909780 2015 A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
25882699 2015 Synergistic induction of apoptosis in high-risk DLBCL by BCL2 inhibition with ABT-199 combined with pharmacologic loss of MCL1.
25873592 2015 The Novel ATP-Competitive MEK/Aurora Kinase Inhibitor BI-847325 Overcomes Acquired BRAF Inhibitor Resistance through Suppression of Mcl-1 and MEK Expression.
25871384 2015 Multiple myeloma induces Mcl-1 expression and survival of myeloid-derived suppressor cells.
25844633 2015 Mapping the BH3 Binding Interface of Bcl-xL, Bcl-2, and Mcl-1 Using Split-Luciferase Reassembly.
25843953 2015 FTY720 enhances TRAIL-mediated apoptosis by up-regulating DR5 and down-regulating Mcl-1 in cancer cells.
25837021 2015 A novel autophagy-independent, oncosuppressive function of BECN1: Degradation of MCL1.
25789974 2015 Regulation of anti-apoptotic signaling by Kruppel-like factors 4 and 5 mediates lapatinib resistance in breast cancer.
25777305 2015 Somatic mutations in myeloid cell leukemia-1 contribute to the pathogenesis of glioma by prolonging its half-life.
25756510 2015 EGFR signaling defines Mcl?1 survival dependency in neuroblastoma.
25733019 2015 CDK1 inhibition targets the p53-NOXA-MCL1 axis, selectively kills embryonic stem cells, and prevents teratoma formation.
25724519 2015 miR-137 and miR-197 Induce Apoptosis and Suppress Tumorigenicity by Targeting MCL-1 in Multiple Myeloma.
25692226 2015 USP9X inhibition promotes radiation-induced apoptosis in non-small cell lung cancer cells expressing mid-to-high MCL1.
25674218 2014 MiR-29a promotes intestinal epithelial apoptosis in ulcerative colitis by down-regulating Mcl-1.
25672320 2015 Myeloid cell leukemia-1 regulates the cell growth and predicts prognosis in gastric cancer.
25647738 2015 Critical contribution of MCL-1 in EMT-associated chemo-resistance in A549 non-small cell lung cancer.
25641608 2015 Novel Mcl-1/Bcl-2 dual inhibitors created by the structure-based hybridization of drug-divided building blocks and a fragment deconstructed from a known two-face BH3 mimetic.
25627260 2015 Calcium signals inhibition sensitizes ovarian carcinoma cells to anti-Bcl-xL strategies through Mcl-1 down-regulation.
25596730 2015 Up-regulation of CDK9 kinase activity and Mcl-1 stability contributes to the acquired resistance to cyclin-dependent kinase inhibitors in leukemia.
25590803 2015 MCL-1 and BCL-xL-dependent resistance to the BCL-2 inhibitor ABT-199 can be overcome by preventing PI3K/AKT/mTOR activation in lymphoid malignancies.
25505074 2015 MCL1 enhances the survival of CD8+ memory T Cells after viral infection.
25499217 2014 Regulation of Mcl-1 expression in context to bone marrow stromal microenvironment in chronic lymphocytic leukemia.
25486070 2015 Mcl-1 antagonism is a potential therapeutic strategy in a subset of solid cancers.
25482013 2015 The FOXM1-induced resistance to oxaliplatin is partially mediated by its novel target gene Mcl-1 in gastric cancer cells.
25472497 2014 Beclin 1 restrains tumorigenesis through Mcl-1 destabilization in an autophagy-independent reciprocal manner.
25456142 2014 Parkin sensitizes toward apoptosis induced by mitochondrial depolarization through promoting degradation of Mcl-1.
25416050 2014 MiR-363 sensitizes cisplatin-induced apoptosis targeting in Mcl-1 in breast cancer.
25409302 2014 Overexpression of Mcl-1L splice variant is associated with poor prognosis and chemoresistance in oral cancers.
25386925 2014 miR-107 activates ATR/Chk1 pathway and suppress cervical cancer invasion by targeting MCL1.
25376373 2015 Hypoxia-induced p38 MAPK activation reduces Mcl-1 expression and facilitates sensitivity towards BH3 mimetics in chronic lymphocytic leukemia.
25375379 2014 Cafestol overcomes ABT-737 resistance in Mcl-1-overexpressed renal carcinoma Caki cells through downregulation of Mcl-1 expression and upregulation of Bim expression.
25362855 2015 A kinase inhibitor screen identifies Mcl-1 and Aurora kinase A as novel treatment targets in antiestrogen-resistant breast cancer cells.
25343522 2014 Trichonomas vaginalis metalloproteinase induces apoptosis of SiHa cells through disrupting the Mcl-1/Bim and Bcl-xL/Bim complexes.
25341036 2014 Mcl-1 promotes lung cancer cell migration by directly interacting with VDAC to increase mitochondrial Ca2+ uptake and reactive oxygen species generation.
25340740 2014 HTLV-1 tax stabilizes MCL-1 via TRAF6-dependent K63-linked polyubiquitination to promote cell survival and transformation.
25314294 2014 Lipid-dependent bimodal MCL1 membrane activity.
25304383 2014 Clitocine induces apoptosis and enhances the lethality of ABT-737 in human colon cancer cells by disrupting the interaction of Mcl-1 and Bak.
25296978 2014 Preclinical efficacy of sepantronium bromide (YM155) in multiple myeloma is conferred by down regulation of Mcl-1.
25275312 2014 IL-32? delays spontaneous apoptosis of human neutrophils through MCL-1, regulated primarily by the p38 MAPK pathway.
25270224 2014 Tanshinone IIA inhibits human gastric carcinoma AGS cell growth by decreasing BiP, TCTP, Mcl?1 and Bcl?xL and increasing Bax and CHOP protein expression.
25231749 2014 Gossypol induces apoptosis in multiple myeloma cells by inhibition of interleukin-6 signaling and Bcl-2/Mcl-1 pathway.
25210795 2014 The ratio of Mcl-1 and Noxa determines ABT737 resistance in squamous cell carcinoma of the skin.
25208882 2014 Inhibition of NANOG/NANOGP8 downregulates MCL-1 in colorectal cancer cells and enhances the therapeutic efficacy of BH3 mimetics.
25196280 2014 Hsp90 inhibitor 17-AAG sensitizes Bcl-2 inhibitor (-)-gossypol by suppressing ERK-mediated protective autophagy and Mcl-1 accumulation in hepatocellular carcinoma cells.
25194337 2014 IL-27 inhibits IFN-? induced autophagy by concomitant induction of JAK/PI3 K/Akt/mTOR cascade and up-regulation of Mcl-1 in Mycobacterium tuberculosis H37Rv infected macrophages.
25107702 2014 MCL-1 dependency of cisplatin-resistant cancer cells.
25091479 2014 p32, a novel binding partner of Mcl-1, positively regulates mitochondrial Ca(2+) uptake and apoptosis.
25084985 2014 ELF-MF attenuates quercetin-induced apoptosis in K562 cells through modulating the expression of Bcl-2 family proteins.
25076060 2014 Marinopyrrole derivatives with sulfide spacers as selective disruptors of Mcl-1 binding to pro-apoptotic protein Bim.
25062042 2014 Regulation of cardiac expression of the diabetic marker microRNA miR-29.
25043081 2014 Expressions of farnesoid X receptor and myeloid cell leukemia sequence 1 protein are associated with poor prognosis in patients with gallbladder cancer.
25024216 2014 Potential pharmacological chaperones targeting cancer-associated MCL-1 and Parkinson disease-associated ?-synuclein.
24999239 2014 Bcl-2 family proteins participate in mitochondrial quality control by regulating Parkin/PINK1-dependent mitophagy.
24991768 2014 Usp9x- and Noxa-mediated Mcl-1 downregulation contributes to pemetrexed-induced apoptosis in human non-small-cell lung cancer cells.
24969872 2014 Bag-1L is a stress-withstand molecule prevents the downregulation of Mcl-1 and c-Raf under control of heat shock proteins in cisplatin treated HeLa cervix cancer cells.
24947165 2014 Anti-apoptotic effects of osteopontin through the up-regulation of Mcl-1 in gastrointestinal stromal tumors.
24939844 2014 Inhibition of protein phosphatase 2A (PP2A) prevents Mcl-1 protein dephosphorylation at the Thr-163/Ser-159 phosphodegron, dramatically reducing expression in Mcl-1-amplified lymphoma cells.
24870742 2014 Exosome-derived microRNA-29c induces apoptosis of BIU-87 cells by down regulating BCL-2 and MCL-1.
24865469 2015 Molecular dynamics study of segment peptides of Bax, Bim, and Mcl-1 BH3 domain of the apoptosis-regulating proteins bound to the anti-apoptotic Mcl-1 protein.
24852432 2014 Revisiting the role of MCL1 in tumorigenesis of solid cancer: gene expression correlates with antiproliferative phenotype in breast cancer cells and its functional regulatory variants are associated with reduced cancer susceptibility.
24811167 2014 The carboxyl-terminal tail of Noxa protein regulates the stability of Noxa and Mcl-1.
24811082 2014 Bak and Mcl-1 are essential for Temozolomide induced cell death in human glioma.
24789074 2014 High-quality NMR structure of human anti-apoptotic protein domain Mcl-1(171-327) for cancer drug design.
24769731 2014 Role of Ku70 in deubiquitination of Mcl-1 and suppression of apoptosis.
24756163 2014 miR-181b increases drug sensitivity in acute myeloid leukemia via targeting HMGB1 and Mcl-1.
24742042 2014 Triptolide induces apoptotic cell death of human cholangiocarcinoma cells through inhibition of myeloid cell leukemia-1.
24735609 2014 Gö6976, a FLT3 kinase inhibitor, exerts potent cytotoxic activity against acute leukemia via inhibition of survivin and MCL-1.
24680709 2014 Imperatorin induces Mcl-1 degradation to cooperatively trigger Bax translocation and Bak activation to suppress drug-resistant human hepatoma.
24650799 2014 PI3K/mTOR dual inhibitor NVP-BEZ235 decreases Mcl-1 expression and sensitizes ovarian carcinoma cells to Bcl-xL-targeting strategies, provided that Bim expression is induced.
24568469 2014 Down-regulation of Mcl-1 by small interference RNA induces apoptosis and sensitizes HL-60 leukemia cells to etoposide.
24564888 2014 Wnt modulates MCL1 to control cell survival in triple negative breast cancer.
24556687 2014 Multiple components of the spliceosome regulate Mcl1 activity in neuroblastoma.
24556678 2014 Antipsychotic agent thioridazine sensitizes renal carcinoma Caki cells to TRAIL-induced apoptosis through reactive oxygen species-mediated inhibition of Akt signaling and downregulation of Mcl-1 and c-FLIP(L).
24529193 2014 Regulation of Mcl-1 by constitutive activation of NF-?B contributes to cell viability in human esophageal squamous cell carcinoma cells.
24525728 2014 Noxa determines localization and stability of MCL-1 and consequently ABT-737 sensitivity in small cell lung cancer.
24481815 2014 STAT3 and MCL-1 associate to cause a mesenchymal epithelial transition.
24469836 2014 Mcl-1 mediates TWEAK/Fn14-induced non-small cell lung cancer survival and therapeutic response.
24369359 2014 Concurrent MCL1 and JUN amplification in pseudomyxoma peritonei: a comprehensive genetic profiling and survival analysis.
24280938 2014 Downregulation of Mcl-1 has anti-inflammatory pro-resolution effects and enhances bacterial clearance from the lung.
24263101 2013 Regulation of cell survival by sphingosine-1-phosphate receptor S1P1 via reciprocal ERK-dependent suppression of Bim and PI-3-kinase/protein kinase C-mediated upregulation of Mcl-1.
24260268 2013 MCL-1ES induces MCL-1L-dependent BAX- and BAK-independent mitochondrial apoptosis.
24234443 2014 RNA-dependent dynamic histone acetylation regulates MCL1 alternative splicing.
24213575 2014 Increased leukocyte survival and accelerated onset of lymphoma in the absence of MCL-1 S159-phosphorylation.
24127964 2013 Apoptosis through regulation of Bcl-2, Bax and Mcl-1 expressions in endometriotic cyst lesions and the endometrium of women with moderate to severe endometriosis.
24118207 2013 Oncogenic BRAF signalling increases Mcl-1 expression in cutaneous metastatic melanoma.
24113155 2013 Placental autophagy regulation by the BOK-MCL1 rheostat.
24091677 2013 Critical role of anti-apoptotic Bcl-2 protein phosphorylation in mitotic death.
24040284 2013 BAD dephosphorylation and decreased expression of MCL-1 induce rapid apoptosis in prostate cancer cells.
24038028 2014 Impact of promoter polymorphisms in key regulators of the intrinsic apoptosis pathway on the outcome of childhood acute lymphoblastic leukemia.
24025188 2013 miR-204 mediated loss of Myeloid cell leukemia-1 results in pancreatic cancer cell death.
24019208 2014 A novel small-molecule inhibitor of mcl-1 blocks pancreatic cancer growth in vitro and in vivo.
23991020 2013 Gemcitabine eliminates double minute chromosomes from human ovarian cancer cells.
23977882 2013 Anti-apoptosis proteins Mcl-1 and Bcl-xL have different p53-binding profiles.
23954445 2013 Simultaneous knock-down of Bcl-xL and Mcl-1 induces apoptosis through Bax activation in pancreatic cancer cells.
23904379 2013 MiR-106a targets Mcl-1 to suppress cisplatin resistance of ovarian cancer A2780 cells.
23887890 2013 Gamma-secretase inhibition attenuates oxaliplatin-induced apoptosis through increased Mcl-1 and/or Bcl-xL in human colon cancer cells.
23883584 2013 Glycolysis inhibition sensitizes non-small cell lung cancer with T790M mutation to irreversible EGFR inhibitors via translational suppression of Mcl-1 by AMPK activation.
23872733 2013 A novel Mcl1 variant inhibits apoptosis via increased Bim sequestration.
23858059 2013 Parkin-dependent degradation of the F-box protein Fbw7? promotes neuronal survival in response to oxidative stress by stabilizing Mcl-1.
23790646 2013 Modulation of Mcl-1 expression reduces age-related cochlear degeneration.
23756231 2013 MicroRNA-133a, downregulated in osteosarcoma, suppresses proliferation and promotes apoptosis by targeting Bcl-xL and Mcl-1.
23750239 2013 MiR-26a inhibits proliferation and migration of breast cancer through repression of MCL-1.
23711389 2013 Opposing Mcl-1, the GALIG proapoptotic gene is upregulated as neutrophils die and underexpressed in Acute Myeloid Leukemia cells.
23696245 2013 Overexpression of Mcl-1 confers multidrug resistance, whereas topoisomerase II? downregulation introduces mitoxantrone-specific drug resistance in acute myeloid leukemia.
23681223 2013 BECN1 and BIM interactions with MCL-1 determine fludarabine resistance in leukemic B cells.
23680104 2013 The novel BH3 ?-helix mimetic JY-1-106 induces apoptosis in a subset of cancer cells (lung cancer, colon cancer and mesothelioma) by disrupting Bcl-xL and Mcl-1 protein-protein interactions with Bak.
23640248 2013 miR-135a/b modulate cisplatin resistance of human lung cancer cell line by targeting MCL1.
23636231 2013 Chrysin overcomes TRAIL resistance of cancer cells through Mcl-1 downregulation by inhibiting STAT3 phosphorylation.
23618862 2013 YM155 induces caspase-8 dependent apoptosis through downregulation of survivin and Mcl-1 in human leukemia cells.
23611778 2013 Aspirin overcomes Navitoclax-resistance in hepatocellular carcinoma cells through suppression of Mcl-1.
23608884 2014 Loss of p53 and altered miR15-a/16-1?MCL-1 pathway in CLL: insights from TCL1-Tg:p53(-/-) mouse model and primary human leukemia cells.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23580240 2013 Concurrent inhibition of PI3K and mTORC1/mTORC2 overcomes resistance to rapamycin induced apoptosis by down-regulation of Mcl-1 in mantle cell lymphoma.
23547049 2013 CD44 regulates the apoptotic response and promotes disease development in chronic lymphocytic leukemia.
23546867 2013 Ionizing radiation-inducible microRNA miR-193a-3p induces apoptosis by directly targeting Mcl-1.
23524145 2013 Enhanced apoptotic effects by downregulating Mcl-1: evidence for the improvement of photodynamic therapy with Celecoxib.
23478333 2013 Programming cancer cells for high expression levels of Mcl1.
23463670 2013 Sorafenib induces endometrial carcinoma apoptosis by inhibiting Elk-1-dependent Mcl-1 transcription and inducing Akt/GSK3?-dependent protein degradation.
23456625 2013 MAPK p38 and JNK have opposing activities on TRAIL-induced apoptosis activation in NSCLC H460 cells that involves RIP1 and caspase-8 and is mediated by Mcl-1.
23455323 2014 Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.
23431241 2013 The role of Mcl-1 in S. aureus-induced cytoprotection of infected macrophages.
23418490 2013 ?Arrestin-1 and Mcl-1 modulate self-renewal growth of cancer stem-like side-population cells in non-small cell lung cancer.
23369735 2013 NF-?B activation fails to protect cells to TNF?-induced apoptosis in the absence of Bcl-xL, but not Mcl-1, Bcl-2 or Bcl-w.
23364598 2013 Activation of triggering receptor expressed on myeloid cells-1 protects monocyte from apoptosis through regulation of myeloid cell leukemia-1.
23341456 2013 The stress protein BAG3 stabilizes Mcl-1 protein and promotes survival of cancer cells and resistance to antagonist ABT-737.
23301543 2013 Persistent hepatitis C virus (HCV) infection impairs HCV-specific cytotoxic T cell reactivity through Mcl-1/Bim imbalance due to CD127 down-regulation.
23257783 2013 MCL1 is deregulated in subgroups of diffuse large B-cell lymphoma.
23245996 2013 Synthetic lethal interaction of combined BCL-XL and MEK inhibition promotes tumor regressions in KRAS mutant cancer models.
23195034 2013 Flavones induce neutrophil apoptosis by down-regulation of Mcl-1 via a proteasomal-dependent pathway.
23174563 2013 Ouabain downregulates Mcl-1 and sensitizes lung cancer cells to TRAIL-induced apoptosis.
23171055 2012 The downregulation of Mcl-1 via USP9X inhibition sensitizes solid tumors to Bcl-xl inhibition.
23158473 2012 Ovarian cancer ascites increase Mcl-1 expression in tumor cells through ERK1/2-Elk-1 signaling to attenuate TRAIL-induced apoptosis.
23088735 2012 Bax/Mcl-1 balance affects neutrophil survival in intermittent hypoxia and obstructive sleep apnea: effects of p38MAPK and ERK1/2 signaling.
23064357 2013 Expression of the enteroviral capsid protein VP1 in the islet cells of patients with type 1 diabetes is associated with induction of protein kinase R and downregulation of Mcl-1.
23059828 2012 Translation inhibitors induce cell death by multiple mechanisms and Mcl-1 reduction is only a minor contributor.
23056582 2012 Thr 163 phosphorylation causes Mcl-1 stabilization when degradation is independent of the adjacent GSK3-targeted phosphodegron, promoting drug resistance in cancer.
23055042 2012 Human Bop is a novel BH3-only member of the Bcl-2 protein family.
23024798 2012 Serine 162, an essential residue for the mitochondrial localization, stability and anti-apoptotic function of Mcl-1.
22994781 2012 Oxaliplatin sensitizes OS cells to TRAIL-induced apoptosis via down-regulation of Mcl1.
22934750 2012 The multi-kinase inhibitor TG02 overcomes signalling activation by survival factors to deplete MCL1 and XIAP and induce cell death in primary acute myeloid leukaemia cells.
22873792 2012 Association of anti-apoptotic Mcl-1L isoform expression with radioresistance of oral squamous carcinoma cells.
22796578 2012 Thrombomodulin protects endothelial cells from a calcineurin inhibitor-induced cytotoxicity by upregulation of extracellular signal-regulated kinase/myeloid leukemia cell-1 signaling.
22686245 2012 Delayed apoptosis by neutrophils from COPD patients is associated with altered Bak, Bcl-xl, and Mcl-1 mRNA expression.
22548841 2012 Genetic variants of NOXA and MCL1 modify the risk of HPV16-associated squamous cell carcinoma of the head and neck.
22527182 2013 Suppression of myeloid cell leukemia-1 (Mcl-1) enhances chemotherapy-associated apoptosis in gastric cancer cells.
22516262 2012 Chemical genomics identifies small-molecule MCL1 repressors and BCL-xL as a predictor of MCL1 dependency.
22496479 2012 N-?-acetyltransferase 10 protein inhibits apoptosis through RelA/p65-regulated MCL1 expression.
22456335 2012 MYC directs transcription of MCL1 and eIF4E genes to control sensitivity of gastric cancer cells toward HDAC inhibitors.
22451485 2012 Inhibition of Mcl-1 promotes senescence in cancer cells: implications for preventing tumor growth and chemotherapy resistance.
22403404 2012 Critical role for antiapoptotic Bcl-xL and Mcl-1 in human macrophage survival and cellular IAP1/2 (cIAP1/2) in resistance to HIV-Vpr-induced apoptosis.
22361683 2012 NOXA, a sensor of proteasome integrity, is degraded by 26S proteasomes by an ubiquitin-independent pathway that is blocked by MCL-1.
22354970 2012 p14(ARF)-induced apoptosis in p53 protein-deficient cells is mediated by BH3-only protein-independent derepression of Bak protein through down-regulation of Mcl-1 and Bcl-xL proteins.
22311987 2012 Discovery of marinopyrrole A (maritoclax) as a selective Mcl-1 antagonist that overcomes ABT-737 resistance by binding to and targeting Mcl-1 for proteasomal degradation.
22292048 2012 Selective induction of cell death in melanoma cell lines through targeting of Mcl-1 and A1.
22279045 2012 Anti-apoptotic Mcl-1 is essential for the development and sustained growth of acute myeloid leukemia.
22277751 2012 Caveolin-1 regulates Mcl-1 stability and anoikis in lung carcinoma cells.
22270368 2012 Up-regulation of pro-apoptotic protein Bim and down-regulation of anti-apoptotic protein Mcl-1 cooperatively mediate enhanced tumor cell death induced by the combination of ERK kinase (MEK) inhibitor and microtubule inhibitor.
22268450 2012 Epstein-Barr virus latent membrane protein-1 protects B-cell lymphoma from rituximab-induced apoptosis through miR-155-mediated Akt activation and up-regulation of Mcl-1.
22266706 2012 Downregulation of Mcl-1 synergizes the apoptotic response to combined treatment with cisplatin and a novel fiber chimeric oncolytic adenovirus.
22257632 2012 Aberrant expression of the apoptosis-related proteins BAK and MCL1 in T cells in multiple sclerosis.
22253918 2012 Up-regulation of Mcl-1 and Bak by coronavirus infection of human, avian and animal cells modulates apoptosis and viral replication.
22231730 2012 Molecular mechanisms underlying delayed apoptosis in neutrophils from multiple trauma patients with and without sepsis.
22203987 2012 Human cytomegalovirus activation of ERK and myeloid cell leukemia-1 protein correlates with survival of latently infected cells.
22194343 2012 Antiapoptotic signaling via MCL1 confers resistance to caspase-3-mediated apoptotic cell death in the pregnant human uterine myocyte.
22188816 2012 Sorafenib sensitizes (-)-gossypol-induced growth suppression in androgen-independent prostate cancer cells via Mcl-1 inhibition and Bak activation.
22125448 2011 Regulation of neutrophil survival/apoptosis by Mcl-1.
22108005 2012 Autophagy-mediated HMGB1 release antagonizes apoptosis of gastric cancer cells induced by vincristine via transcriptional regulation of Mcl-1.
22072062 2012 ER stress sensitizes cells to TRAIL through down-regulation of FLIP and Mcl-1 and PERK-dependent up-regulation of TRAIL-R2.
22056880 2012 Predominant requirement of Bax for apoptosis in HCT116 cells is determined by Mcl-1's inhibitory effect on Bak.
22024133 2012 Cdk1/cyclin B plays a key role in mitotic arrest-induced apoptosis by phosphorylation of Mcl-1, promoting its degradation and freeing Bak from sequestration.
21993632 2012 MiR-101 and Mcl-1 in non-small-cell lung cancer: expression profile and clinical significance.
21983785 2011 Genome-wide association study identifies a new melanoma susceptibility locus at 1q21.3.
21951844 2011 Overexpression of microRNA-29b induces apoptosis of multiple myeloma cells through down regulating Mcl-1.
21947543 2011 The effect of N-nitrosodimethylamine (NDMA) on Bax and Mcl-1 expression in human neutrophils.
21923740 2012 Expression of G protein ?q Subunit is Decreased in Lymphocytes from Patients with Rheumatoid Arthritis and is Correlated with Disease Activity.
21907705 2011 Noxa controls Mule-dependent Mcl-1 ubiquitination through the regulation of the Mcl-1/USP9X interaction.
21899728 2011 c-Myc dependent expression of pro-apoptotic Bim renders HER2-overexpressing breast cancer cells dependent on anti-apoptotic Mcl-1.
21896753 2011 MicroRNA-149*, a p53-responsive microRNA, functions as an oncogenic regulator in human melanoma.
21887682 2012 Functional regulatory variants of MCL1 contribute to enhanced promoter activity and reduced risk of lung cancer in nonsmokers: implications for context-dependent phenotype of an antiapoptotic and antiproliferative gene in solid tumor.
21863213 2011 The p53 upregulated modulator of apoptosis (PUMA) chemosensitizes intrinsically resistant ovarian cancer cells to cisplatin by lowering the threshold set by Bcl-x(L) and Mcl-1.
21846680 2011 ELK4 neutralization sensitizes glioblastoma to apoptosis through downregulation of the anti-apoptotic protein Mcl-1.
21841196 2011 Activating transcription factor-6 (ATF6) mediates apoptosis with reduction of myeloid cell leukemia sequence 1 (Mcl-1) protein via induction of WW domain binding protein 1.
21824245 2011 HIF-1? is involved in mediating apoptosis resistance to Chlamydia trachomatis-infected cells.
21750559 2011 Quercetin downregulates Mcl-1 by acting on mRNA stability and protein degradation.
21734342 2011 Mcl-1 expression is up-regulated in malignancies of the parotid gland.
21730980 2011 Reduced association of anti-apoptotic protein Mcl-1 with E3 ligase Mule increases the stability of Mcl-1 in breast cancer cells.
21674276 2012 The expression of Mcl-1 in human cervical cancer and its clinical significance.
21670080 2011 Akt-dependent glucose metabolism promotes Mcl-1 synthesis to maintain cell survival and resistance to Bcl-2 inhibition.
21659544 2011 Distribution of Bim determines Mcl-1 dependence or codependence with Bcl-xL/Bcl-2 in Mcl-1-expressing myeloma cells.
21628457 2011 Multiple BH3 mimetics antagonize antiapoptotic MCL1 protein by inducing the endoplasmic reticulum stress response and up-regulating BH3-only protein NOXA.
21613222 2011 Mitochondrion-dependent N-terminal processing of outer membrane Mcl-1 protein removes an essential Mule/Lasu1 protein-binding site.
21596068 2011 Baicalein, a component of Scutellaria baicalensis, induces apoptosis by Mcl-1 down-regulation in human pancreatic cancer cells.
21516346 2011 Apoptosis induced by overall metabolic stress converges on the Bcl-2 family proteins Noxa and Mcl-1.
21507240 2011 Role of bile salt in regulating Mcl-1 phosphorylation and chemoresistance in hepatocellular carcinoma cells.
21504623 2011 HBx sensitizes cells to oxidative stress-induced apoptosis by accelerating the loss of Mcl-1 protein via caspase-3 cascade.
21471522 2011 MiR-29a down-regulation in ALK-positive anaplastic large cell lymphomas contributes to apoptosis blockade through MCL-1 overexpression.
21458670 2011 Bcl-x(L) retrotranslocates Bax from the mitochondria into the cytosol.
21454712 2011 Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells.
21423203 2011 Ets-1 mediates upregulation of Mcl-1 downstream of XBP-1 in human melanoma cells upon ER stress.
21412051 2011 MCL-1 regulates the balance between autophagy and apoptosis.
21406400 2011 Interaction between MYC and MCL1 in the genesis and outcome of non-small-cell lung cancer.
21393866 2011 Hypoxic human cancer cells are sensitized to BH-3 mimetic–induced apoptosis via downregulation of the Bcl-2 protein Mcl-1.
21368833 2011 SCF(FBW7) regulates cellular apoptosis by targeting MCL1 for ubiquitylation and destruction.
21292770 2011 Escape from p21-mediated oncogene-induced senescence leads to cell dedifferentiation and dependence on anti-apoptotic Bcl-xL and MCL1 proteins.
21258408 2011 Epidermal growth factor regulates Mcl-1 expression through the MAPK-Elk-1 signalling pathway contributing to cell survival in breast cancer.
21253591 2011 Effective caspase inhibition blocks neutrophil apoptosis and reveals Mcl-1 as both a regulator and a target of neutrophil caspase activation.
21247487 2011 Bim and Mcl-1 exert key roles in regulating JAK2V617F cell survival.
21228225 2011 Hepatitis B virus X protein enhances cisplatin-induced hepatotoxicity via a mechanism involving degradation of Mcl-1.
21220745 2011 c-Abl regulates Mcl-1 gene expression in chronic lymphocytic leukemia cells.
21216463 2011 Cyclin-dependent kinase inhibitor, P276-00 induces apoptosis in multiple myeloma cells by inhibition of Cdk9-T1 and RNA polymerase II-dependent transcription.
21199865 2011 Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis.
21151390 2010 Correlation between Mcl-1 and pAKT protein expression in colorectal cancer.
21148306 2011 The BH3 alpha-helical mimic BH3-M6 disrupts Bcl-X(L), Bcl-2, and MCL-1 protein-protein interactions with Bax, Bak, Bad, or Bim and induces apoptosis in a Bax- and Bim-dependent manner.
21145489 2010 The proapoptotic function of Noxa in human leukemia cells is regulated by the kinase Cdk5 and by glucose.
21139567 2011 MCL-1 is a stress sensor that regulates autophagy in a developmentally regulated manner.
21138867 2010 Quercetin induces tumor-selective apoptosis through downregulation of Mcl-1 and activation of Bax.
21132008 2011 Mcl-1 is critical for survival in a subgroup of non-small-cell lung cancer cell lines.
21036904 2010 Heterodimerization of BAK and MCL-1 activated by detergent micelles.
20921992 2010 Prevention of cytokine withdrawal-induced apoptosis by Mcl-1 requires interaction between Mcl-1 and Bim.
20802294 2010 Polymorphism in tumor necrosis factor-related apoptosis-inducing ligand receptor 1 is associated with poor viral response to interferon-based hepatitis C virus therapy in HIV/hepatitis C virus-coinfected individuals.
20693279 2010 Lyn kinase-dependent regulation of miR181 and myeloid cell leukemia-1 expression: implications for drug resistance in myelogenous leukemia.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20647761 2010 MCL-1 localizes to sites of DNA damage and regulates DNA damage response.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20571074 2010 Mcl-1 stability determines mitotic cell fate of human multiple myeloma tumor cells treated with the kinesin spindle protein inhibitor ARRY-520.
20562877 2010 The MCL-1 BH3 helix is an exclusive MCL-1 inhibitor and apoptosis sensitizer.
20526282 2010 Phosphorylation of Mcl-1 by CDK1-cyclin B1 initiates its Cdc20-dependent destruction during mitotic arrest.
20503275 2011 A novel BH3 mimetic S1 potently induces Bax/Bak-dependent apoptosis by targeting both Bcl-2 and Mcl-1.
20501829 2010 Mechanism by which Mcl-1 regulates cancer-specific apoptosis triggered by mda-7/IL-24, an IL-10-related cytokine.
20467439 2010 ATM-dependent expression of IEX-1 controls nuclear accumulation of Mcl-1 and the DNA damage response.
20392693 2010 Apoptotic regulation by MCL-1 through heterodimerization.
20308427 2010 Endogenous Bak inhibitors Mcl-1 and Bcl-xL: differential impact on TRAIL resistance in Bax-deficient carcinoma.
20197552 2010 Acquired resistance to ABT-737 in lymphoma cells that up-regulate MCL-1 and BFL-1.
20189983 2010 Apoptosis protection by Mcl-1 and Bcl-2 modulation of inositol 1,4,5-trisphosphate receptor-dependent Ca2+ signaling.
20173022 2010 PI3K-dependent upregulation of Mcl-1 by human cytomegalovirus is mediated by epidermal growth factor receptor and inhibits apoptosis in short-lived monocytes.
20156337 2010 The role of glucocorticoid receptor phosphorylation in Mcl-1 and NOXA gene expression.
20085765 2010 Noxa is necessary for hydrogen peroxide-induced caspase-dependent cell death.
20085644 2010 Vascular endothelial growth factor regulates myeloid cell leukemia-1 expression through neuropilin-1-dependent activation of c-MET signaling in human prostate cancer cells.
20066738 2010 Hepatopoietin Cn suppresses apoptosis of human hepatocellular carcinoma cells by up-regulating myeloid cell leukemia-1.
20066663 2010 Mcl-1-Bim complexes accommodate surprising point mutations via minor structural changes.
20051518 2010 The anti-apoptotic protein BCL2L1/Bcl-xL is neutralized by pro-apoptotic PMAIP1/Noxa in neuroblastoma, thereby determining bortezomib sensitivity independent of prosurvival MCL1 expression.
20041405 2010 Effects of microRNA-29 on apoptosis, tumorigenicity, and prognosis of hepatocellular carcinoma.
20038816 2009 Sorafenib inhibits ERK1/2 and MCL-1(L) phosphorylation levels resulting in caspase-independent cell death in malignant pleural mesothelioma.
20023629 2010 Deubiquitinase USP9X stabilizes MCL1 and promotes tumour cell survival.
20004446 2010 Adenovirus-mediated siRNA targeting Mcl-1 gene increases radiosensitivity of pancreatic carcinoma cells in vitro and in vivo.
19968986 2010 Mcl-1(128-350) fragment induces apoptosis through direct interaction with Bax.
19968719 2010 Frequent STAT3 activation is associated with Mcl-1 expression in nasal NK-cell lymphoma.
19968497 2010 Prognostic assessment of three single-nucleotide polymorphisms (GNB3 825C>T, BCL2-938C>A, MCL1-386C>G) in extrahepatic cholangiocarcinoma.
19966861 2010 Glycolysis inhibition sensitizes tumor cells to death receptors-induced apoptosis by AMP kinase activation leading to Mcl-1 block in translation.
19965632 2010 Association of high-level MCL-1 expression with in vitro and in vivo prednisone resistance in MLL-rearranged infant acute lymphoblastic leukemia.
19955184 2010 Vaccinia virus F1L interacts with Bak using highly divergent Bcl-2 homology domains and replaces the function of Mcl-1.
19949310 2010 Downregulation of c-FLIP, XIAP and Mcl-1 protein as well as depletion of reduced glutathione contribute to the apoptosis induction of glycyrrhetinic acid derivatives in leukemia cells.
19942343 2010 Triptolide inhibits Jak2 transcription and induces apoptosis in human myeloproliferative disorder cells bearing Jak2V617F through caspase-3-mediated cleavage of Mcl-1.
19933775 2010 Acquired activation of the Akt/cyclooxygenase-2/Mcl-1 pathway renders lung cancer cells resistant to apoptosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19887550 2009 Mcl-1 is an important determinant of the apoptotic response to the BH3-mimetic molecule HA14-1 in cisplatin-resistant ovarian carcinoma cells.
19841168 2009 Mcl-1-mediated impairment of the intrinsic apoptosis pathway in circulating neutrophils from critically ill patients can be overcome by Fas stimulation.
19840460 2009 [Regulation of 2-methoxyestradiol-induced cell apoptosis by mcl-1 and bax genes in myelodysplastic syndrome].
19838163 2010 Lactate dehydrogenase 5 expression in melanoma increases with disease progression and is associated with expression of Bcl-XL and Mcl-1, but not Bcl-2 proteins.
19808698 2009 FLT3-ITD up-regulates MCL-1 to promote survival of stem cells in acute myeloid leukemia via FLT3-ITD-specific STAT5 activation.
19782681 2009 Differences in TRAIL-induced changes of Mcl-1 expression among distinct human colon epithelial cell lines.
19773546 2009 The BH3-only protein Bim plays a critical role in leukemia cell death triggered by concomitant inhibition of the PI3K/Akt and MEK/ERK1/2 pathways.
19763916 2010 Evaluation of PTEN and Mcl-1 expressions in NSCLC expressing wild-type or mutated EGFR.
19748896 2009 Novel Bcl-2 homology-3 domain-like sequences identified from screening randomized peptide libraries for inhibitors of the pro-survival Bcl-2 proteins.
19737931 2009 p16INK4A sensitizes human leukemia cells to FAS- and glucocorticoid-induced apoptosis via induction of BBC3/Puma and repression of MCL1 and BCL2.
19734538 2009 Mcl-1 degradation during hepatocyte lipoapoptosis.
19684859 2009 RNA silencing of Mcl-1 enhances ABT-737-mediated apoptosis in melanoma: role for a caspase-8-dependent pathway.
19683529 2009 MCL-1ES, a novel variant of MCL-1, associates with MCL-1L and induces mitochondrial cell death.
19676043 2010 Downregulations of B-cell lymphoma 2 and myeloid cell leukemia sequence 1 by microRNA 153 induce apoptosis in a glioblastoma cell line DBTRG-05MG.
19654003 2009 MicroRNA 133B targets pro-survival molecules MCL-1 and BCL2L2 in lung cancer.
19634140 2010 Bcl-XL and MCL-1 constitute pertinent targets in ovarian carcinoma and their concomitant inhibition is sufficient to induce apoptosis.
19616548 2009 The CDK inhibitor, R-roscovitine, promotes eosinophil apoptosis by down-regulation of Mcl-1.
19605477 2009 The hepatitis C virus core protein contains a BH3 domain that regulates apoptosis through specific interaction with human Mcl-1.
19587033 2009 Vesicular stomatitis virus induces apoptosis primarily through Bak rather than Bax by inactivating Mcl-1 and Bcl-XL.
19582795 2009 Prognostic role of myeloid cell leukemia-1 protein (Mcl-1) expression in human gastric cancer.
19581935 2009 The tyrosine kinase Syk regulates the survival of chronic lymphocytic leukemia B cells through PKCdelta and proteasome-dependent regulation of Mcl-1 expression.
19571464 2009 Role of myeloid cell leukemia-1 in cell growth of squamous cell carcinoma.
19549371 2009 [Effect of arsenic trioxide on apoptosis in lymphoblastoid Raji cell line with relation to expression of mcl-1 gene].
19523441 2009 Endocrine glands-derived vascular endothelial growth factor protects pancreatic cancer cells from apoptosis via upregulation of the myeloid cell leukemia-1 protein.
19503096 2009 Chromatin remodeling at Alu repeats by epigenetic treatment activates silenced microRNA-512-5p with downregulation of Mcl-1 in human gastric cancer cells.
19484260 2009 LANA-1, Bcl-2, Mcl-1 and HIF-1alpha protein expression in HIV-associated Kaposi sarcoma.
19481066 2009 Bz-423 superoxide signals B cell apoptosis via Mcl-1, Bak, and Bax.
19401626 2009 Expression of Mcl-1 splicing variants in clear-cell renal cancer and their correlation with histopathological parameters and prognosis.
19372583 2009 Mcl-1 is required for melanoma cell resistance to anoikis.
19369967 2009 Modification of alternative splicing of Mcl-1 pre-mRNA using antisense morpholino oligonucleotides induces apoptosis in basal cell carcinoma cells.
19288493 2009 Role of RAF/MEK/ERK pathway, p-STAT-3 and Mcl-1 in sorafenib activity in human pancreatic cancer cell lines.
19285955 2009 IEX-1-induced cell death requires BIM and is modulated by MCL-1.
19148187 2009 Regulation of heat-induced apoptosis by Mcl-1 degradation and its inhibition by Hsp70.
19099185 2009 Mcl-1 is a potential therapeutic target in multiple types of cancer.
19092849 2009 Inhibition of constitutive and BCR-induced Syk activation downregulates Mcl-1 and induces apoptosis in chronic lymphocytic leukemia B cells.
19077158 2009 Upregulated MCL1 mRNA expression in multiple myeloma lacks association with survival.
19051025 2009 Overexpression of mcl-1 attenuates liver injury and fibrosis in the bile duct-ligated mouse.
19037233 2009 Mcl-1 functions as major epidermal survival protein required for proper keratinocyte differentiation.
19012245 2009 Genetic and molecular alterations in rhabdomyosarcoma: mRNA overexpression of MCL1 and MAP2K4 genes.
19008456 2009 Mcl-1 expression predicts progression-free survival in chronic lymphocytic leukemia patients treated with pentostatin, cyclophosphamide, and rituximab.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18769617 2008 Mcl-1 is a key regulator of apoptosis resistance in Chlamydia trachomatis-infected cells.
18768389 2008 IL-3 induces a Pim1-dependent antiapoptotic pathway in primary human basophils.
18757878 2008 Molecular pathogenesis of megalencephalic leukoencephalopathy with subcortical cysts: mutations in MLC1 cause folding defects.
18676833 2008 Down-regulation of myeloid cell leukemia-1 through inhibiting Erk/Pin 1 pathway by sorafenib facilitates chemosensitization in breast cancer.
18676738 2008 Human papillomavirus type 16/18 up-regulates the expression of interleukin-6 and antiapoptotic Mcl-1 in non-small cell lung cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18647593 2008 Calpain inhibition delays neutrophil apoptosis via cyclic AMP-independent activation of protein kinase A and protein kinase A-mediated stabilization of Mcl-1 and X-linked inhibitor of apoptosis (XIAP).
18609706 2008 Bcl-x(L) and Myeloid cell leukaemia-1 contribute to apoptosis resistance of colorectal cancer cells.
18599795 2008 Mcl-1 expression has in vitro and in vivo significance in chronic lymphocytic leukemia and is associated with other poor prognostic markers.
18552129 2008 Triiodothyronine utilizes phosphatidylinositol 3-kinase pathway to activate anti-apoptotic myeloid cell leukemia-1.
18543107 2008 Inhibition of proteasomal degradation of Mcl-1 by cobalt chloride suppresses cobalt chloride-induced apoptosis in HCT116 colorectal cancer cells.
18495871 2008 An essential role for MCL-1 in ATR-mediated CHK1 phosphorylation.
18483275 2008 Targeting AKT signaling sensitizes cancer to cellular immunotherapy.
18452656 2008 Common MCL1 polymorphisms associated with risk of tuberculosis.
18415656 2008 Anti-myeloma effect of homoharringtonine with concomitant targeting of the myeloma-promoting molecules, Mcl-1, XIAP, and beta-catenin.
18292181 2008 Translation inhibition during cell cycle arrest and apoptosis: Mcl-1 is a novel target for RNA binding protein CUGBP2.
18234961 2008 Down-regulation of mcl-1 by small interfering RNA sensitizes resistant melanoma cells to fas-mediated apoptosis.
18208354 2008 p53-dependent repression of the human MCL-1 gene encoding an anti-apoptotic member of the BCL-2 family: the role of Sp1 and of basic transcription factor binding sites in the MCL-1 promoter.
18178565 2008 Differential regulation of Bax and Bak by anti-apoptotic Bcl-2 family proteins Bcl-B and Mcl-1.
18089567 2008 MCL-1 inhibits BAX in the absence of MCL-1/BAX Interaction.
18088462 2007 [STI571 induces apoptosis of K562 cells through down-regulation of anti-apoptotic protein Mcl-1 and Bcl-xl expression].
18046444 2008 Low MCL-1 mRNA expression correlates with prolonged survival in B-cell chronic lymphocytic leukemia.
18032706 2008 Lentiviral (HIV)-based RNA interference screen in human B-cell receptor regulatory networks reveals MCL1-induced oncogenic pathways.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18025305 2007 Mcl-1 determines the Bax dependency of Nbk/Bik-induced apoptosis.
18006817 2007 Anoikis, initiated by Mcl-1 degradation and Bim induction, is deregulated during oncogenesis.
17942758 2008 The dual effects of TNFalpha on neutrophil apoptosis are mediated via differential effects on expression of Mcl-1 and Bfl-1.
17928528 2008 The Akt/Mcl-1 pathway plays a prominent role in mediating antiapoptotic signals downstream of the B-cell receptor in chronic lymphocytic leukemia B cells.
17927446 2007 Induction of BIM is essential for apoptosis triggered by EGFR kinase inhibitors in mutant EGFR-dependent lung adenocarcinomas.
17893147 2007 Caspase-9-induced mitochondrial disruption through cleavage of anti-apoptotic BCL-2 family members.
17823113 2007 The N terminus of the anti-apoptotic BCL-2 homologue MCL-1 regulates its localization and function.
17805325 2008 Mcl-1 and anticancer vaccination: identification of an HLA-A2-restricted epitope.
17698840 2007 Mcl-1 as a buffer for proapoptotic Bcl-2 family members during TRAIL-induced apoptosis: a mechanistic basis for sorafenib (Bay 43-9006)-induced TRAIL sensitization.
17599053 2007 Sphingosine kinase-1 mediates BCR/ABL-induced upregulation of Mcl-1 in chronic myeloid leukemia cells.
17561513 2007 N-terminal truncation of antiapoptotic MCL1, but not G2/M-induced phosphorylation, is associated with stabilization and abundant expression in tumor cells.
17553788 2007 Translational repression of MCL-1 couples stress-induced eIF2 alpha phosphorylation to mitochondrial apoptosis initiation.
17545167 2007 Survival factor withdrawal-induced apoptosis of TF-1 cells involves a TRB2-Mcl-1 axis-dependent pathway.
17525735 2007 ERK1/2-dependent phosphorylation of BimEL promotes its rapid dissociation from Mcl-1 and Bcl-xL.
17498302 2007 Pre-apoptotic response to therapeutic DNA damage involves protein modulation of Mcl-1, Hdm2 and Flt3 in acute myeloid leukemia cells.
17495975 2007 The novel tyrosine kinase inhibitor EXEL-0862 induces apoptosis in human FIP1L1-PDGFR-alpha-expressing cells through caspase-3-mediated cleavage of Mcl-1.
17463001 2007 Serine 64 phosphorylation enhances the antiapoptotic function of Mcl-1.
17389404 2007 Structural insights into the degradation of Mcl-1 induced by BH3 domains.
17387146 2007 Degradation of Mcl-1 by beta-TrCP mediates glycogen synthase kinase 3-induced tumor suppression and chemosensitization.
17384650 2007 Mcl-1, Bcl-XL and Stat3 expression are associated with progression of melanoma whereas Bcl-2, AP-2 and MITF levels decrease during progression of melanoma.
17227835 2007 The BH3-mimetic GX15-070 synergizes with bortezomib in mantle cell lymphoma by enhancing Noxa-mediated activation of Bak.
17200126 2007 Rapid turnover of mcl-1 couples translation to cell survival and apoptosis.
17145774 2007 Loss of Mcl-1 protein and inhibition of electron transport chain together induce anoxic cell death.
17097560 2006 Mechanisms of apoptosis sensitivity and resistance to the BH3 mimetic ABT-737 in acute myeloid leukemia.
17072336 2007 The antiapoptotic effect of IL-6 autocrine loop in a cellular model of advanced prostate cancer is mediated by Mcl-1.
17009247 2006 Regulation of Mcl-1 expression in rheumatoid arthritis synovial macrophages.
16978419 2006 M. leprae inhibits apoptosis in THP-1 cells by downregulation of Bad and Bak and upregulation of Mcl-1 gene expression.
16969094 2006 Mcl-1 is a relevant molecular target for antisense oligonucleotide strategies in gastric cancer cells.
16901898 2006 The protein kinase C delta catalytic fragment targets Mcl-1 for degradation to trigger apoptosis.
16822835 2006 An internal EELD domain facilitates mitochondrial targeting of Mcl-1 via a Tom70-dependent pathway.
16782027 2006 The Noxa/Mcl-1 axis regulates susceptibility to apoptosis under glucose limitation in dividing T cells.
16761109 2006 Inducer-and cell type-specific regulation of antiapoptotic MCL1 in myeloid leukemia and multiple myeloma cells exposed to differentiation-inducing or microtubule-disrupting agents.
16725198 2007 CD5 provides viability signals to B cells from a subset of B-CLL patients by a mechanism that involves PKC.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16697956 2006 Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members.
16543145 2006 Glycogen synthase kinase-3 regulates mitochondrial outer membrane permeabilization and apoptosis by destabilization of MCL-1.
16538501 2006 Cyclin E but not bcl-2, bax or mcl-1 is differentially expressed in ZAP 70-positive and ZAP 70-negative B-CLL cells.
16478725 2006 Interrelated roles for Mcl-1 and BIM in regulation of TRAIL-mediated mitochondrial apoptosis.
16456709 2006 Mcl-1: a highly regulated cell death and survival controller.
16380381 2006 Mcl-1 interacts with truncated Bid and inhibits its induction of cytochrome c release and its role in receptor-mediated apoptosis.
16339575 2005 Mcl-1 is essential for the survival of synovial fibroblasts in rheumatoid arthritis.
16327976 2006 Mcl-1 is an anti-apoptotic factor for human hepatocellular carcinoma.
16289418 2006 Mcl-1 overexpression in hepatocellular carcinoma: a potential target for antisense therapy.
16229017 2006 HIF-1alpha has an anti-apoptotic effect in human airway epithelium that is mediated via Mcl-1 gene expression.
16213503 2005 BH3-ligand regulates access of MCL-1 to its E3 ligase.
16109713 2005 Apoptosis induced by the kinase inhibitor BAY 43-9006 in human leukemia cells involves down-regulation of Mcl-1 through inhibition of translation.
16091744 2005 Melphalan-induced apoptosis in multiple myeloma cells is associated with a cleavage of Mcl-1 and Bim and a decrease in the Mcl-1/Bim complex.
16027162 2005 The anti-apoptotic protein Mcl-1 inhibits mitochondrial Ca2+ signals.
16007132 2005 Puma(*)Mcl-1 interaction is not sufficient to prevent rapid degradation of Mcl-1.
15989957 2005 Mule/ARF-BP1, a BH3-only E3 ubiquitin ligase, catalyzes the polyubiquitination of Mcl-1 and regulates apoptosis.
15940637 2005 Interleukin-6 contributes to Mcl-1 up-regulation and TRAIL resistance via an Akt-signaling pathway in cholangiocarcinoma cells.
15902294 2005 Mcl-1 is overexpressed in multiple myeloma and associated with relapse and shorter survival.
15901672 2005 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins.
15842635 2005 Overexpression of anti-apoptotic Mcl-1 in testicular germ cell tumours.
15753661 2005 Mcl-1 regulates survival and sensitivity to diverse apoptotic stimuli in human non-small cell lung cancer cells.
15728130 2005 Sustained signaling through the B-cell receptor induces Mcl-1 and promotes survival of chronic lymphocytic leukemia B cells.
15713684 2005 Disruption of Mcl-1.Bim complex in granzyme B-mediated mitochondrial apoptosis.
15694340 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function.
15637055 2005 Specific cleavage of Mcl-1 by caspase-3 in tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis in Jurkat leukemia T cells.
15626746 2005 Identification of mcl-1 as a BCR/ABL-dependent target in chronic myeloid leukemia (CML): evidence for cooperative antileukemic effects of imatinib and mcl-1 antisense oligonucleotides.
15613543 2005 Evidence for a protective role of Mcl-1 in proteasome inhibitor-induced apoptosis.
15611089 2005 Hypoxia-inducible factor-1-dependent overexpression of myeloid cell factor-1 protects hypoxic cells against tert-butyl hydroperoxide-induced apoptosis.
15588513 2004 Enhancement of cell survival by stromal cell-derived factor-1/CXCL12 involves activation of CREB and induction of Mcl-1 and c-Fos in factor-dependent human cell line MO7e.
15550399 2005 Solution structure of prosurvival Mcl-1 and characterization of its binding by proapoptotic BH3-only ligands.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378010 2004 Cleavage of Mcl-1 by caspases impaired its ability to counteract Bim-induced apoptosis.
15370246 2004 Role of myeloid cell factor-1 (Mcl-1) in chronic lymphocytic leukemia.
15262975 2004 Antiapoptotic protein partners fortilin and MCL1 independently protect cells from 5-fluorouracil-induced cytotoxicity.
15241487 2004 MCL1 is phosphorylated in the PEST region and stabilized upon ERK activation in viable cells, and at additional sites with cytotoxic okadaic acid or taxol.
15217829 2004 VEGF induces Mcl-1 up-regulation and protects multiple myeloma cells against apoptosis.
15126604 2004 Prognostic significance of a short sequence insertion in the MCL-1 promoter in chronic lymphocytic leukemia.
15122313 2004 Mcl-1 is required for Akata6 B-lymphoma cell survival and is converted to a cell death molecule by efficient caspase-mediated cleavage.
15078892 2004 Granulocyte macrophage colony-stimulating factor signaling and proteasome inhibition delay neutrophil apoptosis by increasing the stability of Mcl-1.
15077116 2004 Mitochondrial p53 activates Bak and causes disruption of a Bak-Mcl1 complex.
15014070 2004 Degradation of Mcl-1 by granzyme B: implications for Bim-mediated mitochondrial apoptotic events.
14982947 2004 Interleukin-15 delays human neutrophil apoptosis by intracellular events and not via extracellular factors: role of Mcl-1 and decreased activity of caspase-3 and caspase-8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14633975 2003 DNA damage response and MCL-1 destruction initiate apoptosis in adenovirus-infected cells.
12960271 2003 Neutrophil activation by fMLP regulates FOXO (forkhead) transcription factors by multiple pathways, one of which includes the binding of FOXO to the survival factor Mcl-1.
12915532 2003 Respiratory syncytial virus infection sensitizes cells to apoptosis mediated by tumor necrosis factor-related apoptosis-inducing ligand.
12901848 2003 Shiga toxin induces decreased expression of the anti-apoptotic protein Mcl-1 concomitant with the onset of endothelial apoptosis.
12855556 2003 Inhibition of protein geranylgeranylation induces apoptosis in myeloma plasma cells by reducing Mcl-1 protein levels.
12787138 2003 Mcl-1 antisense therapy chemosensitizes human melanoma in a SCID mouse xenotransplantation model.
12783855 2003 Elimination of Mcl-1 is required for the initiation of apoptosis following ultraviolet irradiation.
12782407 2003 Islet cell hyperplasia in transgenic mice overexpressing EAT/mcl-1, a bcl-2 related gene.
12660820 2003 IL-6-independent expression of Mcl-1 in human multiple myeloma.
12637318 2003 Serine phosphorylation of STAT3 is essential for Mcl-1 expression and macrophage survival.
12496428 2003 Survival of Mycobacterium tuberculosis in host macrophages involves resistance to apoptosis dependent upon induction of antiapoptotic Bcl-2 family member Mcl-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475993 2003 Tankyrase 1 interacts with Mcl-1 proteins and inhibits their regulation of apoptosis.
12445202 2002 The phosphotidyl inositol 3-kinase/Akt signal pathway is involved in interleukin-6-mediated Mcl-1 upregulation and anti-apoptosis activity in basal cell carcinoma cells.
12359245 2002 Relationship of Mcl-1 isoforms, ratio p21WAF1/cyclin A, and Jun kinase phosphorylation to apoptosis in human breast carcinomas.
12223490 2002 Phosphorylation and inactivation of myeloid cell leukemia 1 by JNK in response to oxidative stress.
12176902 2002 Protection of CLL B cells by a follicular dendritic cell line is dependent on induction of Mcl-1.
12149273 2002 Physical and functional interaction between myeloid cell leukemia 1 protein (MCL1) and Fortilin. The potential role of MCL1 as a fortilin chaperone.
12070027 2002 Antisense strategy shows that Mcl-1 rather than Bcl-2 or Bcl-x(L) is an essential survival protein of human myeloma cells.
11911971 2002 Expression of apoptotic regulators and their significance in cervical cancer.
11781193 Immunoexpressions of p21, Rb, mcl-1 and bad gene products in normal, hyperplastic and carcinomatous human prostates.
11598139 2001 Characterization of fortilin, a novel antiapoptotic protein.
11546872 2001 Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis.
11483855 2001 Underphosphorylated BAD interacts with diverse antiapoptotic Bcl-2 family proteins to regulate apoptosis.
11130466 2000 Functional analysis of the human MCL-1 gene.
10978339 2000 Regulation of apoptosis and cell cycle progression by MCL1. Differential role of proliferating cell nuclear antigen.
10965038 2000 A subunit of the mammalian oligosaccharyltransferase, DAD1, interacts with Mcl-1, one of the bcl-2 protein family.
10837489 2000 MCL-1S, a splicing variant of the antiapoptotic BCL-2 family member MCL-1, encodes a proapoptotic protein possessing only the BH3 domain.
10766760 2000 Exon skipping in Mcl-1 results in a bcl-2 homology domain 3 only gene product that promotes cell death.
10634649 2000 Acute myeloid leukemia possessing jumping translocation is related to highly elevated levels of EAT/mcl-1, a Bcl-2 related gene with anti-apoptotic functions.
10579309 1999 Characterization of the antiapoptotic Bcl-2 family member myeloid cell leukemia-1 (Mcl-1) and the stimulation of its message by gonadotropins in the rat ovary.
9671497 1998 mcl-1 is an immediate-early gene activated by the granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling pathway and is one component of the GM-CSF viability response.
9356461 1997 Bok is a pro-apoptotic Bcl-2 protein with restricted expression in reproductive tissues and heterodimerizes with selective anti-apoptotic Bcl-2 family members.
9184696 1997 The apoptosis and proliferation of SAC-activated B cells by IL-10 are associated with changes in Bcl-2, Bcl-xL, and Mcl-1 expression.
8790944 1996 Induction of mcl1/EAT, Bcl-2 related gene, by retinoic acid or heat shock in the human embryonal carcinoma cells, NCR-G3.
7896880 1995 The intracellular distribution and pattern of expression of Mcl-1 overlap with, but are not identical to, those of Bcl-2.
7835896 1994 Human and mouse chromosomal mapping of the myeloid cell leukemia-1 gene: MCL1 maps to human chromosome 1q21, a region that is frequently altered in preneoplastic and neoplastic disease.
7682708 1993 MCL1, a gene expressed in programmed myeloid cell differentiation, has sequence similarity to BCL2.