Property Summary

NCBI Gene PubMed Count 41
PubMed Score 311.52
PubTator Score 156.96

Knowledge Summary

Patent (20,907)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.500 7.1e-03
Astrocytoma, Pilocytic 1.100 8.4e-03
atypical teratoid / rhabdoid tumor -1.500 1.9e-03
ependymoma -1.500 6.8e-03
group 4 medulloblastoma -1.300 4.8e-03
medulloblastoma, large-cell -1.600 2.3e-03
oligodendroglioma -1.400 7.5e-03
pancreatic ductal adenocarcinoma liver m... -1.387 4.6e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (31)

AA Sequence

MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWM      1 - 70
DLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKL     71 - 140
HWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDR    141 - 210
YLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLY    211 - 280
QFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLS    281 - 350
ISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK    351 - 420
GT                                                                        421 - 422
//

Text Mined References (43)

PMID Year Title