Property Summary

NCBI Gene PubMed Count 41
PubMed Score 299.46
PubTator Score 156.96

Knowledge Summary

Patent (20,907)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1795 4.60051774325495E-4
medulloblastoma 1524 0.00108084384003513
atypical teratoid / rhabdoid tumor 4369 0.00188984143100215
medulloblastoma, large-cell 6234 0.0023159403055797
pilocytic astrocytoma 3086 0.00855276134535328
astrocytic glioma 2241 0.00979491862020809
ependymoma 2514 0.0183271097769646
oligodendroglioma 2849 0.0205562634609362
Disease Target Count Z-score Confidence
Obesity 616 5.168 2.6
Vitiligo 71 3.482 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.900 0.010
ependymoma -1.900 0.018
oligodendroglioma -1.600 0.021
medulloblastoma -1.400 0.001
atypical teratoid / rhabdoid tumor -1.500 0.002
medulloblastoma, large-cell -1.600 0.002
pancreatic ductal adenocarcinoma liver m... -1.387 0.000
pilocytic astrocytoma 1.300 0.009

Synonym

Accession Q99705 B2RBX6 Q5R3J1 Q96S47 Q9BV08 MCH receptor 1
Symbols SLC1
GPR24
MCH1R
SLC-1
MCH-1R

Gene

PANTHER Protein Class (2)

  Ortholog (12)

  TechDev Info (1)

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
1880 summary 2 / 0 / 0 Summary of probe development efforts to identify antagonists of the G-protein coupled receptor 7 (GPR7).
2148 screening 1471 / 0 / 910 Fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based high throughput screening assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1).
2257 confirmatory 7 / 0 / 119 Fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based high throughput dose response assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1).
463250 confirmatory 54 / 0 / 31 Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based dose response assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1)
504889 confirmatory 15 / 0 / 10 Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based dose response assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1) Set 2
540371 confirmatory 15 / 0 / 16 Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based dose response assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1) Set 3
588563 confirmatory 37 / 0 / 51 Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based dose response assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1) Set 5
588568 confirmatory 72 / 0 / 59 Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based dose response assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1) Set 4
588581 confirmatory 73 / 0 / 11 Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based dose response assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1) Set 6

Gene RIF (31)

PMID Text
24305679 Polymorphisms in the MCHR1 gene are associated with differences in body composition and interact with physiologic and energy-related lifestyle factors.
22154049 SLC-1 protein human mutation demonstrated important genetic susceptibility of sporadic nonsyndromic hearing loss in China.
22081064 results suggest that MCHR1 may influence schizophrenia susceptibility, in particular among men and patients responding to conventional (nonclozapine) treatment
21637341 DNA methylation at MCHR1 is allele-specific, age-dependent, body mass index-associated and affects transcription.
20888736 MCHR1 expression level was 1.6 times higher in vitiligo uninvolved skin (P < 0.05) and 2.23 times lower in involved skin (P < 0.05), when compared to healthy control skin.
20833795 two loss-of-function mutants were identified in markedly underweight individuals, raising the possibility that a lean phenotype may be linked to deficient MCHR1 signaling
20734064 Observational study of gene-disease association. (HuGE Navigator)
20633139 data suggest that RGS2 and RGS8 differentially associate with MCHR1 and may represent two distinct modes of signaling mechanisms in vivo
19502010 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWM      1 - 70
DLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKL     71 - 140
HWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDR    141 - 210
YLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLY    211 - 280
QFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLS    281 - 350
ISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK    351 - 420
GT                                                                        421 - 422
//

Text Mined References (43)

PMID Year Title
24305679 2014 Melanin-concentrating hormone receptor 1 polymorphisms are associated with components of energy balance in the Complex Diseases in the Newfoundland Population: Environment and Genetics (CODING) study.
22154049 2012 Microarray-based mutation detection of pediatric sporadic nonsyndromic hearing loss in China.
22081064 2012 The gene encoding the melanin-concentrating hormone receptor 1 is associated with schizophrenia in a Danish case-control sample.
21637341 2011 Allele-specific, age-dependent and BMI-associated DNA methylation of human MCHR1.
20888736 2010 Analysis of the expression profile of CRH-POMC system genes in vitiligo skin biopsies.
20833795 2010 Two naturally occurring mutations in the type 1 melanin-concentrating hormone receptor abolish agonist-induced signaling.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20633139 2010 Functional interaction of regulator of G protein signaling-2 with melanin-concentrating hormone receptor 1.
19502010 2009 Two complex genotypes relevant to the kynurenine pathway and melanotropin function show association with schizophrenia and bipolar disorder.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
More...