Property Summary

NCBI Gene PubMed Count 34
PubMed Score 310.76
PubTator Score 107.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 1.1e-02
ependymoma -2.000 2.1e-02
oligodendroglioma -1.200 2.4e-02
glioblastoma -1.700 8.0e-03
medulloblastoma -2.400 1.1e-07
atypical teratoid / rhabdoid tumor -2.500 2.8e-09
medulloblastoma, large-cell -2.300 6.8e-04
primitive neuroectodermal tumor -1.700 1.9e-03
adrenocortical carcinoma -2.008 2.0e-02
adult high grade glioma -2.100 5.7e-05
aldosterone-producing adenoma -1.454 2.4e-02
pituitary cancer 2.800 1.7e-04

 MGI Phenotype (1)

Gene RIF (10)

PMID Text
25723869 Results support a role for Dbl oncogene in mammary epithelial cell differentiation and transformation and suggest the relevance of GEF deregulation in tumor onset and progression.
22984590 Phosphoinositide 3-kinase C2beta regulates RhoA and the actin cytoskeleton through an interaction with Dbl
21712385 Dbl is regulated by hamartin through association with ezrin.
20479760 Observational study of gene-disease association. (HuGE Navigator)
19373475 proto-oncogene dbl is not a major target for sporadic testicular germ cell tumors
18728402 Nm23-H1 can negatively regulate cell migration and tumor metastasis by modulating the activity of Cdc42 and possibly other Rho family members through interaction with Dbl-1
17606614 Galphaq directly activates p63RhoGEF and Trio via a conserved extension of the Dbl homology-associated pleckstrin homology domain
17538024 These data suggest a mechanism whereby precise spatial guanine nucleotide exchange of Cdc42 by Dbl is dependent on functional ERM proteins and is important for directional cell migration.
13679059 provides fundamental data on the structure of Mcf-2, which regulates a variety of cellular signaling pathways
12445822 data describe 4 splicing variants of the human DBL (MCF-2) proto-oncogene that show different tissue distributions and guanine nucleotide exchange factor specificities

AA Sequence

MAEANPRRGKMRFRRNAASFPGNLHLVLVLRPTSFLQRTFTDIGFWFSQEDFMLKLPVVMLSSVSDLLTY      1 - 70
IDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAE     71 - 140
RYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQVHDMETAFDGFWEKH    141 - 210
QLKMEQYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLSKAQFVIL    211 - 280
HGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQARQCCDEGECLLANQEI    281 - 350
DKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPELKVQMKTIQLKLENIRSIFENQQAG    351 - 420
FRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQGKKTWRQNQSNLKIEVVPDCQEKRSSGPSSSLDNGN    421 - 490
SLDVLKNHVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIF    491 - 560
LSSLENCAHAPERVGPCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLK    561 - 630
PVQRITKYQLLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGF    631 - 700
SVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEYVK    701 - 770
GDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQND    771 - 840
EKQQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEE    841 - 910
NRPLMRPVSEMALLY                                                           911 - 925
//

Text Mined References (37)

PMID Year Title
25723869 2015 Dbl oncogene expression in MCF-10 A epithelial cells disrupts mammary acinar architecture, induces EMT and angiogenic factor secretion.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22984590 2012 Phosphoinositide 3-kinase C2? regulates RhoA and the actin cytoskeleton through an interaction with Dbl.
21712385 2011 The tumor suppressor hamartin enhances Dbl protein transforming activity through interaction with ezrin.
20479760 2011 Systematic resequencing of X-chromosome synaptic genes in autism spectrum disorder and schizophrenia.
19373475 2009 Mutational analysis of proto-oncogene Dbl on Xq27 in testicular germ cell tumors reveals a rare SNP in a patient with bilateral undescended testis.
18728402 2008 The suppressor of metastasis Nm23-H1 interacts with the Cdc42 Rho family member and the pleckstrin homology domain of oncoprotein Dbl-1 to suppress cell migration.
18470881 2008 Nm23-H1 modulates the activity of the guanine exchange factor Dbl-1.
17606614 2007 Galphaq directly activates p63RhoGEF and Trio via a conserved extension of the Dbl homology-associated pleckstrin homology domain.
17538024 2007 Activated ezrin promotes cell migration through recruitment of the GEF Dbl to lipid rafts and preferential downstream activation of Cdc42.
17000758 2006 Ccpg1, a novel scaffold protein that regulates the activity of the Rho guanine nucleotide exchange factor Dbs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15157669 2004 Role of the Sec14-like domain of Dbl family exchange factors in the regulation of Rho family GTPases in different subcellular sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13679059 2003 Characterization of novel splicing variants of the mouse MCF-2 (DBL) proto-oncogene.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12445822 2002 Alternative splicing variants of the human DBL (MCF-2) proto-oncogene.
12376551 2002 RhoG signals in parallel with Rac1 and Cdc42.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
11907027 2002 Regulation of proto-Dbl by intracellular membrane targeting and protein stability.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11134331 2001 Oligomerization of DH domain is essential for Dbl-induced transformation.
11062019 2000 Activation of RhoA by association of Galpha(13) with Dbl.
10925207 2000 Human dbl proto-oncogene in 85 kb of xq26, and determination of the transcription initiation site.
10854437 2000 Identification of Rho GTPase-dependent sites in the Dbl homology domain of oncogenic Dbl that are required for transformation.
10652228 2000 Activation of the guanine nucleotide exchange factor Dbl following ACK1-dependent tyrosine phosphorylation.
10518015 1999 Association of the proto-oncogene product dbl with G protein betagamma subunits.
9681826 1998 Interaction of radixin with Rho small G protein GDP/GTP exchange protein Dbl.
8276860 1994 Cellular transformation and guanine nucleotide exchange activity are catalyzed by a common domain on the dbl oncogene product.
3491366 1986 Identification of the protein encoded by the human diffuse B-cell lymphoma (dbl) oncogene.
3281159 1988 The predicted DBL oncogene product defines a distinct class of transforming proteins.
3056717 1988 Molecular cloning and characterization of the human dbl proto-oncogene: evidence that its overexpression is sufficient to transform NIH/3T3 cells.
2613238 1989 Chromosomal localization of DBL oncogene sequences.
2577874 1988 Activation of a mcf.2 oncogene by deletion of amino-terminal coding sequences.
2065022 1991 A region of proto-dbl essential for its transforming activity shows sequence similarity to a yeast cell cycle gene, CDC24, and the human breakpoint cluster gene, bcr.
1611909 1992 Localization of the 5' end of the MCF2 oncogene to human chromosome 15q15----q23.