Property Summary

Ligand Count 1,050
NCBI Gene PubMed Count 366
PubMed Score 930.17
PubTator Score 744.09

Knowledge Summary

Patent (70,078)

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus 1.100 2.2e-03
astrocytic glioma -1.300 2.8e-02
ependymoma -1.600 2.7e-02
oligodendroglioma -1.600 1.3e-02
pituitary cancer 1.500 2.4e-02

Gene RIF (380)

AA Sequence

MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIA      1 - 70
KNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSL     71 - 140
LSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMAS    141 - 210
LYVHMFLMARLHIKRIAVLPGTGAIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCF    211 - 280
MSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYPLGGLCDLSSRY                      281 - 332
//

Text Mined References (368)

PMID Year Title