Property Summary

NCBI Gene PubMed Count 713
PubMed Score 522.83
PubTator Score 1667.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -4.617 1.1e-03

Gene RIF (834)

AA Sequence

MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ      1 - 70
GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFL     71 - 140
TNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNE    141 - 210
GEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI                                    211 - 248
//

Text Mined References (718)

PMID Year Title