Property Summary

NCBI Gene PubMed Count 29
PubMed Score 28.60
PubTator Score 17.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical adenoma -1.125 4.7e-02
adrenocortical carcinoma -2.485 1.7e-04
adult high grade glioma 1.900 1.3e-03
astrocytic glioma 2.300 3.0e-02
Astrocytoma, Pilocytic 2.800 2.6e-10
autosomal dominant Emery-Dreifuss muscul... 1.657 4.9e-03
Breast cancer -4.300 1.9e-15
breast carcinoma -2.000 1.2e-07
cutaneous lupus erythematosus -1.300 2.9e-03
cystic fibrosis -2.003 9.1e-07
Duchenne muscular dystrophy 1.107 4.9e-05
ductal carcinoma in situ -2.400 1.6e-04
ependymoma 1.800 8.0e-05
glioblastoma 1.600 2.3e-03
invasive ductal carcinoma -2.202 2.2e-05
malignant mesothelioma -1.700 2.5e-07
nephrosclerosis 1.321 8.3e-04
oligodendroglioma 1.200 4.1e-06
osteosarcoma 1.763 1.5e-02
ovarian cancer -2.000 2.0e-03
progressive supranuclear palsy -1.100 4.1e-02
psoriasis -1.600 2.1e-08
subependymal giant cell astrocytoma 2.655 2.8e-02
ulcerative colitis -1.800 4.8e-08

Gene RIF (14)

AA Sequence

MEKMLAGCFLLILGQIVLLPAEARERSRGRSISRGRHARTHPQTALLESSCENKRADLVFIIDSSRSVNT      1 - 70
HDYAKVKEFIVDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAI     71 - 140
QYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEVAAKARDTGILIFAIGVGQVDFNTLKSIGSE    141 - 210
PHEDHVFLVANFSQIETLTSVFQKKLCTAHMCSTLEHNCAHFCINIPGSYVCRCKQGYILNSDQTTCRIQ    211 - 280
DLCAMEDHNCEQLCVNVPGSFVCQCYSGYALAEDGKRCVAVDYCASENHGCEHECVNADGSYLCQCHEGF    281 - 350
ALNPDKKTCTKIDYCASSNHGCQHECVNTDDSYSCHCLKGFTLNPDKKTCRRINYCALNKPGCEHECVNM    351 - 420
EESYYCRCHRGYTLDPNGKTCSRVDHCAQQDHGCEQLCLNTEDSFVCQCSEGFLINEDLKTCSRVDYCLL    421 - 490
SDHGCEYSCVNMDRSFACQCPEGHVLRSDGKTCAKLDSCALGDHGCEHSCVSSEDSFVCQCFEGYILRED    491 - 560
GKTCRRKDVCQAIDHGCEHICVNSDDSYTCECLEGFRLAEDGKRCRRKDVCKSTHHGCEHICVNNGNSYI    561 - 630
CKCSEGFVLAEDGRRCKKCTEGPIDLVFVIDGSKSLGEENFEVVKQFVTGIIDSLTISPKAARVGLLQYS    631 - 700
TQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGEGARPLSTRVPRAAIVFTDGR    701 - 770
AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED    771 - 840
SDGRQDSPAGELPKTVQQPTESEPVTINIQDLLSCSNFAVQHRYLFEEDNLLRSTQKLSHSTKPSGSPLE    841 - 910
EKHDQCKCENLIMFQNLANEEVRKLTQRLEEMTQRMEALENRLRYR                            911 - 956
//

Text Mined References (31)

PMID Year Title