Property Summary

NCBI Gene PubMed Count 25
PubMed Score 26.31
PubTator Score 17.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
nephrosclerosis 1.321 8.3e-04
malignant mesothelioma -1.700 2.5e-07
astrocytic glioma 2.300 3.0e-02
psoriasis -1.600 2.1e-08
cutaneous lupus erythematosus -1.300 2.9e-03
glioblastoma multiforme 1.900 4.1e-16
oligodendroglioma 1.200 4.1e-06
osteosarcoma 1.763 1.5e-02
posterior fossa group B ependymoma 2.600 5.1e-10
cystic fibrosis -2.003 9.1e-07
Duchenne muscular dystrophy 1.107 4.9e-05
autosomal dominant Emery-Dreifuss muscul... 1.657 4.9e-03
adrenocortical adenoma -1.125 4.7e-02
adrenocortical carcinoma -2.485 1.7e-04
breast carcinoma -2.800 4.0e-44
adult high grade glioma 1.900 1.3e-03
pilocytic astrocytoma 2.800 3.4e-10
subependymal giant cell astrocytoma 2.655 2.8e-02
invasive ductal carcinoma -3.600 3.9e-03
Breast cancer -4.300 1.9e-15
progressive supranuclear palsy -1.100 4.1e-02
ductal carcinoma in situ -2.400 1.6e-04
ulcerative colitis -2.100 2.2e-04
ovarian cancer -2.000 2.0e-03

Gene RIF (11)

PMID Text
26271809 Matrilin-2 induces post-burn inflammatory responses as an endogenous danger signal, partly through a TLR4-mediated mechanism
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
18386166 data indicate matrilin-2 is a novel basement membrane component in the liver, synthesized during sinusoidal "capillarization" in cirrhosis & in hepatocellular carcinoma
18328806 DeltaNp63/BMP-7 signaling pathway modulates wound healing process through the regulation of matrilin-2.
16401863 These results suggest that matrilin-2 may be a specific and clinically useful biomarker for discriminating between indolent and clinically aggressive pilocytic astrocytoma.
12180907 study of interactions by which matrilin-2 can be integrated into extracellular filamentous networks
12164922 matrilin-2 is expressed in normal skin by keratinocytes and fibroblasts and may thus contribute to cutaneous homeostasis.
11852232 matrilin-2, a filament-forming protein widely distributed in extracellular matrices.

AA Sequence

MEKMLAGCFLLILGQIVLLPAEARERSRGRSISRGRHARTHPQTALLESSCENKRADLVFIIDSSRSVNT      1 - 70
HDYAKVKEFIVDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAI     71 - 140
QYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEVAAKARDTGILIFAIGVGQVDFNTLKSIGSE    141 - 210
PHEDHVFLVANFSQIETLTSVFQKKLCTAHMCSTLEHNCAHFCINIPGSYVCRCKQGYILNSDQTTCRIQ    211 - 280
DLCAMEDHNCEQLCVNVPGSFVCQCYSGYALAEDGKRCVAVDYCASENHGCEHECVNADGSYLCQCHEGF    281 - 350
ALNPDKKTCTKIDYCASSNHGCQHECVNTDDSYSCHCLKGFTLNPDKKTCRRINYCALNKPGCEHECVNM    351 - 420
EESYYCRCHRGYTLDPNGKTCSRVDHCAQQDHGCEQLCLNTEDSFVCQCSEGFLINEDLKTCSRVDYCLL    421 - 490
SDHGCEYSCVNMDRSFACQCPEGHVLRSDGKTCAKLDSCALGDHGCEHSCVSSEDSFVCQCFEGYILRED    491 - 560
GKTCRRKDVCQAIDHGCEHICVNSDDSYTCECLEGFRLAEDGKRCRRKDVCKSTHHGCEHICVNNGNSYI    561 - 630
CKCSEGFVLAEDGRRCKKCTEGPIDLVFVIDGSKSLGEENFEVVKQFVTGIIDSLTISPKAARVGLLQYS    631 - 700
TQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGEGARPLSTRVPRAAIVFTDGR    701 - 770
AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED    771 - 840
SDGRQDSPAGELPKTVQQPTESEPVTINIQDLLSCSNFAVQHRYLFEEDNLLRSTQKLSHSTKPSGSPLE    841 - 910
EKHDQCKCENLIMFQNLANEEVRKLTQRLEEMTQRMEALENRLRYR                            911 - 956
//

Text Mined References (27)

PMID Year Title
26271809 2015 The extracellular matrix protein matrilin-2 induces post-burn inflammatory responses as an endogenous danger signal.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
18386166 2008 Expression of matrilin-2 in liver cirrhosis and hepatocellular carcinoma.
18328806 2008 DeltaNp63/BMP-7-dependent expression of matrilin-2 is involved in keratinocyte migration in response to wounding.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16401863 2006 Matrilin-2 expression distinguishes clinically relevant subsets of pilocytic astrocytoma.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12180907 2002 Matrilin-2 interacts with itself and with other extracellular matrix proteins.
12164922 2002 Expression of matrilin-2 in human skin.
11896063 2002 Characterization of the matrilin coiled-coil domains reveals seven novel isoforms.
11852232 2002 Comparative analysis of the mouse and human genes (Matn2 and MATN2) for matrilin-2, a filament-forming protein widely distributed in extracellular matrices.
11124542 2000 Primary structure of human matrilin-2, chromosome location of the MATN2 gene and conservation of an AT-AC intron in matrilin genes.
9083061 1997 Primary structure and expression of matrilin-2, the closest relative of cartilage matrix protein within the von Willebrand factor type A-like module superfamily.