Property Summary

NCBI Gene PubMed Count 93
PubMed Score 35.58
PubTator Score 231.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.092 1.1e-02
Multiple myeloma 1.501 5.5e-04
astrocytoma 1.300 2.6e-03
glioblastoma 1.300 1.8e-03
oligodendroglioma 1.100 3.3e-10
osteosarcoma 1.053 1.7e-03
ependymoma 1.400 1.5e-14
medulloblastoma 1.200 1.9e-06
atypical teratoid / rhabdoid tumor 1.200 3.3e-04
medulloblastoma, large-cell 1.500 2.6e-04
primitive neuroectodermal tumor 1.200 1.9e-06
juvenile dermatomyositis 1.050 1.8e-11
breast carcinoma 1.500 1.9e-03
pediatric high grade glioma 1.100 8.6e-06
ovarian cancer 2.000 1.5e-04
dermatomyositis 1.200 3.0e-03

Protein-protein Interaction (172)

SFI1   PLK4   NDC80   AURKA   XPO1   CEP290   NPHP1   ZW10   CCP110   BUB1   SSNA1   RAD21   BUB1B   DIAPH2   CLASP2   NPHP4   OFD1   DCTN3   HAUS5   CEP152   CCNB2   ZWINT   PCNT   FGFR1OP   TUBB4A   CDK1   TUBB   CCNB1   TUBG1   CLIP1   PPP1CC   CETN2   RPS27   RANGAP1   CENPF   RANBP2   KNTC1   NEK2   NUP98   PLK1   SEC13   NUP107   CDC42   RAB8A   RAB11A   TUBA4A   TUBB4B   CENPE   CDC20   MAD2L1   ITGB3BP   DCTN2   DCTN1   SMC1A   IQCB1   PCM1   PDS5A   TCTN1   ERCC6L   C2CD3   CDCA8   SGO2   ODF2   SGO1   TMEM67   CEP78   KIF24   CEP162   CEP135   RPGRIP1L   HAUS3   CENPP   TTBK2   TCTN3   PMF1   BORA   CENPU   TUBA1A   CENPQ   TAOK1   CLASP1   HAUS6   WAPL   CNTRL   SDCCAG8   CEP57   CEP97   CENPL   AHI1   CENPS   STAG2   KIF2B   SPC24   NUP43   NUP37   KNL1   CEP70   NEDD1   KIF18A   CEP76   ALMS1   CEP192   FBF1   NUP133   SKA2   STAG1   AHCTF1   SKA1   CENPT   HAUS1   OPTN   SPDL1   SEH1L   CDCA5   AURKB   TCTN2   CENPN   AJUBA   NSL1   MARK4   CEP63   SCLT1   RAB3IP   CDK5RAP2   CEP89   HAUS7   B9D2   CENPK   HAUS8   CENPO   CEP250   NUP85   HDAC8   CEP41   NUF2   NDEL1   MIS12   CENPH   HAUS4   ZWILCH   SPC25   CENPJ   INCENP   TUBG2   CENPM   PDS5B   HAUS2   MKS1   NDE1   GTSE1   TMEM216   CEP72   RCC2   CC2D2A   TPX2   B9D1   CEP131   CEP164   SMC3   NUDC   NINL   CEP83   MAD1L1   DST   MACF1   PPP1R13L   PRKAR2B   AKAP9   MAPRE2   MAPRE3   KIF18B   PDE4DIP  

Gene RIF (49)

PMID Text
26854759 The authors show that the microtubule binding protein EB1 (end-binding protein 1), a key regulator of microtubule dynamics, can bind directly to filamentous actin (F-actin) F-actin.
26498358 We propose a novel mechanism by which ATIP3-EB1 interaction indirectly reduces the kinetics of EB1 exchange on its recognition site, thereby accounting for negative regulation of microtubule dynamic instability
26342024 MAPRE1 can contribute to the detection of early-stage colorectal cancer and adenomas together with other biomarkers
25355949 A previously uncharacterized EB1 linker region tracks microtubule plus ends in live cells.
25297623 TTBK2 bound EB1 and Cep164 through its SxIP motifs and a proline-rich motif, respectively.
25225338 a subset of arrhythmogenic cardiomyopathy mutations, in addition to a mutation associated with skin fragility/woolly hair syndrome, impair gap junction localization and function by misregulating DP-EB1 interactions and altering microtubule dynamics.
25164813 EB1 has a role in linking AIM2 inflammasomes with autophagy-dependent secretion
25160006 We find that the presence of EB1 can stiffen microtubules in a manner that depends on the hydrolysis state of the tubulin-bound nucleotide
25048701 The functions of EB1 in the regulation of microtubule dynamics and recruitment of other +TIPs, as well as the dimerization of EB1, undergo exquisite control by phosphorylation.
25022754 Studies show that IQGAP1 functions as a hub linking HGF-induced signaling to microtubules and actin remodeling via EB1-IQGAP1-cortactin interactions.
24930764 We showed for the first time that EB1 associates with microtubules in a phosphorylation-dependent manner, under control of reactive oxygen species
24725408 Study finds that frictional forces increase nonlinearly with microtubule-associated proteins (MAP) velocity across microtubules and depend on filament polarity, with NuMA's friction being lower when moving toward minus ends, EB1's lower toward plus ends, and PRC1's exhibiting no directional preference.
24616220 EB1 enables the spindle microtubules to regulate the phosphorylation of kinetochores through recruitment of the Aurora B kinase.
24552808 The CYLD-EB1 interaction was confirmed both in cells and in vitro, and these 2 proteins colocalized at the plus ends of microtubules. The association of CYLD with EB1 was significantly increased upon the stimulation of cell migration.
24492008 Dysregulation of EB1 is an important early event in colon carcinogenesis
24478452 Aptamers binding to human EB1 and EB3, which have sequence requirements similar to but distinct from each other and from Drosophila EB1, were identified.
24462004 EB1-kinesin complex actively steered growing microtubules in an in vitro model
24237699 EB1-mediated stable microtubules enhance HIV-1 infection and is required for efficient translocation of HIV-1 GFP-Vpr labelled viral particles across the cytoplasm
24040250 EB1 and EB3 proteins are obligatory dimers.
23900080 Depletion of end-binding protein 1 (EB1) promotes apoptosis of human non-small-cell lung cancer cells via reactive oxygen species and Bax-mediated mitochondrial dysfunction.
23871111 EB proteins appear to play an active role inthe subsequent association of STIM1 to APC at the ER-PM junction.
23864329 regulation of EB1 dimerization might play a role in controlling EB1 function
23687376 phosphorylation of STIM1 at Ser575, Ser608 and Ser621 regulates the interaction with EB1.
23595990 TIP150-EB1 interaction governs kinetochore microtubule plus-end plasticity and establish that the temporal control of the TIP150-EB1 interaction by PCAF acetylation ensures chromosome stability in mitosis.
23251535 These observations indicate that EB1 and ch-TOG regulate microtubule organisation differently via distinct regions in the plus ends of microtubules.
23128140 the intramolecular interaction site of EB1 overlaps the MT binding sites, indicating that the MT binding sites are masked by interaction with the C-terminal domain.
23001180 Data indicate that EB1 is a substrate of P300/CBP-associated factor (PCAF) and K220 was identified as a responsible site.
22898821 the Amer2-EB1-APC complex regulates cell migration by altering microtubule stability.
22869553 End binding protein 1 directly interacted with AIM2 and ASC in vitro and in vivo.
22748319 STIM1 dissociates from EB1 in mitosis.
22735596 EB1 is a potential biomarker and therapeutic target in colorectal cancer.
22543185 We further demonstrate that this binding was prevented when the C-terminal tyrosine of EB1 was absent in the peptidic probes.
22467876 Multisite phosphorylation disrupts arginine-glutamate salt bridge networks required for binding of cytoplasmic linker-associated protein 2 (CLASP2) to end-binding protein 1 (EB1).
22277732 Increased plasma levels of the APC-interacting protein MAPRE1, LRG1, and IGFBP2 precede a diagnosis of colorectal cancer in women
21768326 Data indicated that EB1 and EB3 interact with proteins implicated in MT minus-end anchoring or vesicular trafficking to the cilia base, suggesting that EB1 and EB3 promote ciliogenesis by facilitating such trafficking.
21737692 Insights into EB1 structure and the role of its C-terminal domain for discriminating microtubule tips from the lattice
21737685 Kif18B is a new MT dynamics regulatory protein that interacts with EB1 to control astral MT length
21562367 decreased MAPRE1 expression coincided with increased miR-10b expression, suggesting that miR-10b targets MAPRE1 transcription
20696710 Targeting of KIF17 to plus ends of growing microtubules requires kinesin motor activity and interaction with EB1.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20008324 heterodimer formation between EB1 and EB3, but not between EB2 and the other two EBs, occurs both in vitro and in cells as revealed by live cell imaging
19255245 Protein depletion and rescue experiments showed that EB1 and EB3, but not EB2, promote persistent microtubule growth by suppressing catastrophes.
19126680 EB1 specifically recognizes the distinct lattice structure at the growing microtubule end; EB1 is both necessary and sufficient to mediate plus-end tracking by CLIP-170.
18937283 Proteomic profiling revealed the molecular signature behind the progression of hepatocellular carcinoma (HCC), and the prognostic value of EB1 in HCC.
18477699 Aurora-B is an EB1-interacting protein; EB1 stimulates Aurora-B activity through antagonizing its dephosphorylation/inactivation by PP2A
17968321 MCAK is held in an inactive conformation when associated with EB1
16030254 APC and EB1 together give rise to similar defects in mitotic spindles and chromosome alignment without arresting cells in mitosis.
14514668 neither APC nor p150glued binding domain is necessary for EB1 or EBF3 to induce microtubule bundling
12857735 EB1 employs the hydrophobic interaction to bind to microtubules

AA Sequence

MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE      1 - 70
YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPS     71 - 140
LVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDL    141 - 210
EKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY                211 - 268
//

Text Mined References (107)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26854759 2016 Interactions between the Microtubule Binding Protein EB1 and F-Actin.
26498358 2015 Negative regulation of EB1 turnover at microtubule plus ends by interaction with microtubule-associated protein ATIP3.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26485573 2015 Cep169, a Novel Microtubule Plus-End-Tracking Centrosomal Protein, Binds to CDK5RAP2 and Regulates Microtubule Stability.
26342024 2015 MAPRE1 as a plasma biomarker for early-stage colorectal cancer and adenomas.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25355949 2014 Superresolution imaging reveals structural features of EB1 in microtubule plus-end tracking.
25297623 2014 Binding to Cep164, but not EB1, is essential for centriolar localization of TTBK2 and its function in ciliogenesis.
25225338 2014 Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions.
25164813 2014 The microtubule-associated protein EB1 links AIM2 inflammasomes with autophagy-dependent secretion.
25160006 2014 Mechanical effects of EB1 on microtubules depend on GTP hydrolysis state and presence of paclitaxel.
25048701 2014 Phosphoregulation of the dimerization and functions of end-binding protein 1.
25022754 2014 IQGAP1 regulates endothelial barrier function via EB1-cortactin cross talk.
24930764 2014 ROS-mediated EB1 phosphorylation through Akt/GSK3? pathway: implication in cancer cell response to microtubule-targeting agents.
24725408 2014 Asymmetric friction of nonmotor MAPs can lead to their directional motion in active microtubule networks.
24616220 2014 EB1 enables spindle microtubules to regulate centromeric recruitment of Aurora B.
24552808 2014 CYLD coordinates with EB1 to regulate microtubule dynamics and cell migration.
24492008 2014 End-binding protein 1 (EB1) up-regulation is an early event in colorectal carcinogenesis.
24478452 2014 Peptide aptamers define distinct EB1- and EB3-binding motifs and interfere with microtubule dynamics.
24462004 2014 An EB1-kinesin complex is sufficient to steer microtubule growth in vitro.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24040250 2013 End binding proteins are obligatory dimers.
23900080 2013 Depletion of end-binding protein 1 (EB1) promotes apoptosis of human non-small-cell lung cancer cells via reactive oxygen species and Bax-mediated mitochondrial dysfunction.
23874158 2013 Dynactin subunit p150(Glued) is a neuron-specific anti-catastrophe factor.
23871111 2013 A relay mechanism between EB1 and APC facilitate STIM1 puncta assembly at endoplasmic reticulum-plasma membrane junctions.
23864329 2013 Biochemical evidence that human EB1 does not bind preferentially to the microtubule seam.
23687376 2013 Phosphorylation of STIM1 at ERK1/2 target sites regulates interaction with the microtubule plus-end binding protein EB1.
23595990 2013 Regulation of a dynamic interaction between two microtubule-binding proteins, EB1 and TIP150, by the mitotic p300/CBP-associated factor (PCAF) orchestrates kinetochore microtubule plasticity and chromosome stability during mitosis.
23527680 2013 Genome-wide association study of inattention and hyperactivity-impulsivity measured as quantitative traits.
23509069 2013 MISP is a novel Plk1 substrate required for proper spindle orientation and mitotic progression.
23251535 2012 Dissecting the nanoscale distributions and functions of microtubule-end-binding proteins EB1 and ch-TOG in interphase HeLa cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128140 2013 Microtubule-binding sites of the CH domain of EB1 and its autoinhibition revealed by NMR.
23035123 2012 Mitotic regulator SKAP forms a link between kinetochore core complex KMN and dynamic spindle microtubules.
23001180 2012 EB1 acetylation by P300/CBP-associated factor (PCAF) ensures accurate kinetochore-microtubule interactions in mitosis.
22898821 2012 Amer2 protein interacts with EB1 protein and adenomatous polyposis coli (APC) and controls microtubule stability and cell migration.
22869553 2012 Interactome-wide analysis identifies end-binding protein 1 as a crucial component for the speck-like particle formation of activated absence in melanoma 2 (AIM2) inflammasomes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22748319 2012 Phosphoregulation of STIM1 leads to exclusion of the endoplasmic reticulum from the mitotic spindle.
22735596 2012 Proteomic-based identification of the APC-binding protein EB1 as a candidate of novel tissue biomarker and therapeutic target for colorectal cancer.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22543185 2012 Tyrosine-dependent capture of CAP-Gly domain-containing proteins in complex mixture by EB1 C-terminal peptidic probes.
22467876 2012 Multisite phosphorylation disrupts arginine-glutamate salt bridge networks required for binding of cytoplasmic linker-associated protein 2 (CLASP2) to end-binding protein 1 (EB1).
22277732 2012 Increased plasma levels of the APC-interacting protein MAPRE1, LRG1, and IGFBP2 preceding a diagnosis of colorectal cancer in women.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21820309 2011 A complex of Kif18b and MCAK promotes microtubule depolymerization and is negatively regulated by Aurora kinases.
21768326 2011 EB1 and EB3 promote cilia biogenesis by several centrosome-related mechanisms.
21737692 2011 Insights into EB1 structure and the role of its C-terminal domain for discriminating microtubule tips from the lattice.
21737685 2011 Kif18B interacts with EB1 and controls astral microtubule length during mitosis.
21646404 2011 SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase.
21562367 2011 Epigenetic regulation of microRNA-10b and targeting of oncogenic MAPRE1 in gastric cancer.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20696710 2010 KIF17 stabilizes microtubules and contributes to epithelial morphogenesis by acting at MT plus ends with EB1 and APC.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20008324 2010 Molecular insights into mammalian end-binding protein heterodimerization.
19632184 2009 An EB1-binding motif acts as a microtubule tip localization signal.
19553473 2009 Interaction of CDK5RAP2 with EB1 to track growing microtubule tips and to regulate microtubule dynamics.
19543227 2009 TIP150 interacts with and targets MCAK at the microtubule plus ends.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19255245 2009 Mammalian end binding proteins control persistent microtubule growth.
19126680 2009 Microtubule plus-end tracking by CLIP-170 requires EB1.
18937283 2008 Proteomic profiling reveals the prognostic value of adenomatous polyposis coli-end-binding protein 1 in hepatocellular carcinoma.
18477699 2008 EB1 promotes Aurora-B kinase activity through blocking its inactivation by protein phosphatase 2A.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17968321 2008 MCAK associates with EB1.
17889670 2007 Structural basis of microtubule plus end tracking by XMAP215, CLIP-170, and EB1.
17563362 2007 Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition.
17002498 2006 Adenomatous polyposis coli (APC) is required for normal development of skin and thymus.
16949363 2006 Key interaction modes of dynamic +TIP networks.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16455083 2006 Microtubule binding proteins CLIP-170, EB1, and p150Glued form distinct plus-end complexes.
16109370 2005 Structural basis for the activation of microtubule assembly by the EB1 and p150Glued complex.
16030254 2005 APC and EB1 function together in mitosis to regulate spindle dynamics and chromosome alignment.
15631994 2005 CLASP1 and CLASP2 bind to EB1 and regulate microtubule plus-end dynamics at the cell cortex.
15616574 2005 Structural insights into the EB1-APC interaction.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14514668 2003 Characterization of functional domains of human EB1 family proteins.
12857735 2003 Crystal structure of the amino-terminal microtubule-binding domain of end-binding protein 1 (EB1).
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12686597 2003 The microtubule plus-end proteins EB1 and dynactin have differential effects on microtubule polymerization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475954 2002 EB1 targets to kinetochores with attached, polymerizing microtubules.
12388762 2002 Evidence that an interaction between EB1 and p150(Glued) is required for the formation and maintenance of a radial microtubule array anchored at the centrosome.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11943150 2002 Involvement of the telomeric protein Pin2/TRF1 in the regulation of the mitotic spindle.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11701125 2001 The Pin2/TRF1-interacting protein PinX1 is a potent telomerase inhibitor.
11470413 2001 Critical role for the EB1 and APC interaction in the regulation of microtubule polymerization.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10899006 2000 The dynamic behavior of the APC-binding protein EB1 on the distal ends of microtubules.
10811817 2000 EB1 proteins regulate microtubule dynamics, cell polarity, and chromosome stability.
10773885 2000 Regulation and function of the interaction between the APC tumour suppressor protein and EB1.
10644998 2000 EB3, a novel member of the EB1 family preferentially expressed in the central nervous system, binds to a CNS-specific APC homologue.
10226031 1999 The APC-associated protein EB1 associates with components of the dynactin complex and cytoplasmic dynein intermediate chain.
10188731 1999 EB/RP gene family encodes tubulin binding proteins.
10030671 1998 EB1, a protein which interacts with the APC tumour suppressor, is associated with the microtubule cytoskeleton throughout the cell cycle.
9724749 1998 The adenomatous polyposis coli-binding protein EB1 is associated with cytoplasmic and spindle microtubules.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7606712 1995 APC binds to the novel protein EB1.