Property Summary

NCBI Gene PubMed Count 60
PubMed Score 83.17
PubTator Score 43.27

Knowledge Summary

Patent (12,035)

Expression

  Differential Expression (5)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (31)

PMID Text
26843485 p38gamma and p38delta reprogram liver metabolism by modulating neutrophil infiltration and provide a potential target for NAFLD therapy
26708186 during interphase ERK3 is mainly resident in the nucleoplasm in association with ribonuclear proteins involved in early pre-mRNA splicing, it undergoes cell cycle-dependent redistribution and, during apoptosis
26588708 Taken together our data suggest that as cells initiate adhesion to matrix increasing levels of ERK3 at the cell periphery are required to orchestrate cell morphology changes which can then drive migratory behavior.
26418945 This study reveals a novel pathway that directly links ErbB4 and p38gamma to the transcriptional machinery of NKx2.5-GATA4 complex which is critical for cardiomyocyte formation during mammalian heart development.
25314968 analysis of how allosteric regulation of p38gamma and PTPN3 involves a PDZ domain-modulated complex formation
22730327 SEPW1 silencing increases MKK4, which activates p38gamma, p38delta, and JNK2 to phosphorylate p53 on Ser-33 and cause a transient G(1) arrest.
22730326 p38gamma Mitogen-activated protein kinase signals through phosphorylating its phosphatase PTPH1 in regulating ras protein oncogenesis and stress response.
22522454 Thus, in endothelial cells p38alpha mediates apoptotic signaling, whereas p38beta and p38gamma transduce survival signaling
22399296 phosphorylation at Ser-118 is required for ER to bind both p38gamma and c-Jun, thereby promoting ER relocation from ERE to AP-1 promoter sites.
21878638 a new paradigm in which p38gamma actively regulates the drug-Topo IIalpha signal transduction, and this may be exploited to increase the therapeutic activity of Topo II drugs.
21862636 p38gamma mitogen-activated protein kinase regulates breast cancer cell motility and metastasis, in part, by controlling expression of the metastasis-associated small GTPase RhoC.
21532888 demonstrates that p38gamma MAPK is a promising target for the design of targeted therapies for basal-like breast cancer with metastatic characteristics and for overcoming potential resistance against the PARP inhibitor
21172807 The majority of p38gamma-depleted cells die at mitotic arrest or soon after abnormal exit from M-phase.
20804750 Isoforms of p38MAPK gamma and delta contribute to differentiation of human AML cells induced by 1,25-dihydroxyvitamin D.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20605917 In response to hyperosmotic stress, p38 also regulates formation of complexes between hDlg and PSF.
20332238 PTPH1 plays a role in Ras-dependent malignant growth of colon cancer by a mechanism depending on its p38gamma-binding activity.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19251701 p38alpha and p38gamma are essential components of the signaling pathway that regulates the tumor-suppressing senescence response
18559936 These results suggest that, in SupT1-based cell lines, p38alpha, p38gamma and p38delta, but not p38beta, are implicated in both HIV-1 induced replication and apoptosis in infected and uninfected bystander cells.
17724032 Mapk14 antagonizes Mapk12 activity through c-jun-dependent ubiquitin-proteasome pathways in regulating Ras transformation and stress response.
17088247 hyperactive variants of p38alpha induce, whereas hyperactive variants of p38gamma suppress, activating protein 1-mediated transcription
15342622 Data show that in response to radiation, MRK controls two independent pathways: the Chk2-Cdc25A pathway leading to cell cycle arrest and the p38gamma MAPK pathway.
15158451 SAPK3 phosphorylates mitochondrial protein Sab
14592936 data suggest that p38gamma increases basal glucose uptake and decreases DNP- and contraction-stimulated glucose uptake, partially by affecting levels of glucose transporter expression in skeletal muscle
12915405 CRM1 binds to ERK3and promotes the cytoplasmic relocalization of ERK3. Enforced localization of ERK3 in the nucleus or cytoplasm markedly attenuates the ability of the kinase to induce cell cycle arrest in fibroblasts.
12536241 IL-2 and polysaccharide K increased the expression of ERK3.
12239168 HIV-1 gp120 binding to CD4 results in activation of the mitogen-activated protein kinase (MAPK) in CD4(+) lymphocytes prestimulated through their T-cell receptor (TCR)
11991731 Cardiac expression and subcellular localization
11741894 C-terminal halves of ERK2 and ERK3DeltaC are primarily responsible for subcellular localization in resting cells; and the N-terminal folding domain of ERK2 is required for its activation in cells, interaction with MEK1, and accumulation in the nucleus
9564043 HIV-1 gp120 binding to CD4 results in activation of the mitogen-activated protein kinase (MAPK) in CD4(+) lymphocytes prestimulated through their T-cell receptor (TCR)

AA Sequence

MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKR      1 - 70
AYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKG     71 - 140
LRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIW    141 - 210
SVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNA    211 - 280
SPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLS    281 - 350
FKPPRQLGARVSKETPL                                                         351 - 367
//

Text Mined References (66)

PMID Year Title
26843485 2016 p38? and p38? reprogram liver metabolism by modulating neutrophil infiltration.
26708186 2015 Analysis of ERK3 intracellular localization: dynamic distribution during mitosis and apoptosis.
26588708 2015 A novel role for atypical MAPK kinase ERK3 in regulating breast cancer cell morphology and migration.
26418945 2016 ErbB4 Activated p38? MAPK Isoform Mediates Early Cardiogenesis Through NKx2.5 in Human Pluripotent Stem Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25314968 2014 Reciprocal allosteric regulation of p38? and PTPN3 involves a PDZ domain-modulated complex formation.
25158884 2014 Regulation of the catalytic activity of the human phosphatase PTPN4 by its PDZ domain.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22730327 2012 Delayed cell cycle progression in selenoprotein W-depleted cells is regulated by a mitogen-activated protein kinase kinase 4-p38/c-Jun NH2-terminal kinase-p53 pathway.
22730326 2012 p38? Mitogen-activated protein kinase signals through phosphorylating its phosphatase PTPH1 in regulating ras protein oncogenesis and stress response.
22522454 2012 TGF-?1 induces endothelial cell apoptosis by shifting VEGF activation of p38(MAPK) from the prosurvival p38? to proapoptotic p38?.
22399296 2012 p38? mitogen-activated protein kinase (MAPK) confers breast cancer hormone sensitivity by switching estrogen receptor (ER) signaling from classical to nonclassical pathway via stimulating ER phosphorylation and c-Jun transcription.
21878638 2011 Phosphorylation and stabilization of topoisomerase II? protein by p38? mitogen-activated protein kinase sensitize breast cancer cells to its poisons.
21862636 2011 p38? promotes breast cancer cell motility and metastasis through regulation of RhoC GTPase, cytoskeletal architecture, and a novel leading edge behavior.
21532888 2011 p38? mitogen-activated protein kinase contributes to oncogenic properties maintenance and resistance to poly (ADP-ribose)-polymerase-1 inhibition in breast cancer.
21269460 2011 Initial characterization of the human central proteome.
21172807 2011 Loss of p38gamma MAPK induces pleiotropic mitotic defects and massive cell death.
20804750 2011 Isoforms of p38MAPK gamma and delta contribute to differentiation of human AML cells induced by 1,25-dihydroxyvitamin D?.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626350 2010 Mechanisms and functions of p38 MAPK signalling.
20605917 2010 p38gamma regulates interaction of nuclear PSF and RNA with the tumour-suppressor hDlg in response to osmotic shock.
20332238 2010 PTPH1 dephosphorylates and cooperates with p38gamma MAPK to increase ras oncogenesis through PDZ-mediated interaction.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19294699 2009 Proteomic analysis of GTP cyclohydrolase 1 multiprotein complexes in cultured normal adult human astrocytes under both basal and cytokine-activated conditions.
19251701 2009 p38alpha and p38gamma mediate oncogenic ras-induced senescence through differential mechanisms.
18559936 2008 Implication of p38 mitogen-activated protein kinase isoforms (alpha, beta, gamma and delta) in CD4+ T-cell infection with human immunodeficiency virus type I.
18221368 2008 Biochemical aspects of the neuroprotective mechanism of PTEN-induced kinase-1 (PINK1).
17724032 2007 p38alpha antagonizes p38gamma activity through c-Jun-dependent ubiquitin-proteasome pathways in regulating Ras transformation and stress response.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17088247 2007 Hyperactive variants of p38alpha induce, whereas hyperactive variants of p38gamma suppress, activating protein 1-mediated transcription.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15850461 2005 The phosphorylation of CapZ-interacting protein (CapZIP) by stress-activated protein kinases triggers its dissociation from CapZ.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342622 2004 The stress kinase MRK contributes to regulation of DNA damage checkpoints through a p38gamma-independent pathway.
15284239 2004 Active mutants of the human p38alpha mitogen-activated protein kinase.
15158451 2004 Phosphorylation of the mitochondrial protein Sab by stress-activated protein kinase 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592936 2004 p38gamma MAPK regulation of glucose transporter expression and glucose uptake in L6 myotubes and mouse skeletal muscle.
12915405 2003 Nuclear export of ERK3 by a CRM1-dependent mechanism regulates its inhibitory action on cell cycle progression.
12761180 2003 Regulation of a mitogen-activated protein kinase kinase kinase, MLTK by PKN.
12536241 2003 Different regulation of PKC isoenzymes and MAPK by PSK and IL-2 in the proliferative and cytotoxic activities of the NKL human natural killer cell line.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12171600 2002 Stress-induced regulation of eukaryotic elongation factor 2 kinase by SB 203580-sensitive and -insensitive pathways.
12167088 2002 A new c-Jun N-terminal kinase (JNK)-interacting protein, Sab (SH3BP5), associates with mitochondria.
11991731 2002 Cardiac expression and subcellular localization of the p38 mitogen-activated protein kinase member, stress-activated protein kinase-3 (SAPK3).
11741894 2002 Different domains of the mitogen-activated protein kinases ERK3 and ERK2 direct subcellular localization and upstream specificity in vivo.
11520933 2001 Nerve growth factor signaling, neuroprotection, and neural repair.
11062068 2000 Catalytic activation of mitogen-activated protein (MAP) kinase phosphatase-1 by binding to p38 MAP kinase: critical role of the p38 C-terminal domain in its negative regulation.
11062067 2000 Synergistic activation of stress-activated protein kinase 1/c-Jun N-terminal kinase (SAPK1/JNK) isoforms by mitogen-activated protein kinase kinase 4 (MKK4) and MKK7.
11010976 2000 Differential activation of p38 mitogen-activated protein kinase isoforms depending on signal strength.
10848581 2000 Involvement of the MKK6-p38gamma cascade in gamma-radiation-induced cell cycle arrest.
10591208 1999 The DNA sequence of human chromosome 22.
10567720 1999 Kinetic mechanism and ATP-binding site reactivity of p38gamma MAP kinase.
10508788 1999 The structure of phosphorylated p38gamma is monomeric and reveals a conserved activation-loop conformation.
10212242 1999 Stress-activated protein kinase-3 interacts with the PDZ domain of alpha1-syntrophin. A mechanism for specific substrate recognition.
9628874 1998 PRAK, a novel protein kinase regulated by the p38 MAP kinase.
9430721 1998 Selective activation of p38 mitogen-activated protein (MAP) kinase isoforms by the MAP kinase kinases MKK3 and MKK6.
9297626 1997 Ras effectors and their role in mitogenesis and oncogenesis.
9199504 1997 Phosphorylation of microtubule-associated protein tau by stress-activated protein kinases.
9169156 1997 Assignment of the human stress-activated protein kinase-3 gene (SAPK3) to chromosome 22q13.3 by fluorescence in situ hybridization.
9019171 1995 Involvement of stress-activated protein kinase in the cellular response to 1-beta-D-arabinofuranosylcytosine and other DNA-damaging agents.
8920915 1996 The primary structure of p38 gamma: a new member of p38 group of MAP kinases.
8633070 1996 ERK6, a mitogen-activated protein kinase involved in C2C12 myoblast differentiation.