Property Summary

Ligand Count 8
NCBI Gene PubMed Count 65
PubMed Score 88.41
PubTator Score 43.27

Knowledge Summary

Patent (12,035)

Expression

  Differential Expression (5)

Protein-protein Interaction (4)

Gene RIF (33)

AA Sequence

MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKR      1 - 70
AYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKG     71 - 140
LRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIW    141 - 210
SVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNA    211 - 280
SPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLS    281 - 350
FKPPRQLGARVSKETPL                                                         351 - 367
//

Text Mined References (71)

PMID Year Title