Property Summary

NCBI Gene PubMed Count 123
PubMed Score 119.44
PubTator Score 172.34

Knowledge Summary

Patent (30,258)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
46,XY SEX REVERSAL 6 1 0.0 0.0
Breast Neoplasms 423 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.1
Disease Target Count Z-score Confidence
Breast cancer 3469 0.0 2.87108647938604E-5
Type 2 diabetes mellitus 268 0.0 1.1
Disease Target Count Z-score Confidence
Langerhans-cell histiocytosis 12 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2388 4.009 2.0

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer -1.300 2.9e-05
adult high grade glioma 1.100 1.2e-02
astrocytoma 1.100 5.4e-09
Astrocytoma, Pilocytic 1.700 6.4e-08
cystic fibrosis -1.786 3.1e-04
glioblastoma 1.100 1.0e-02
group 3 medulloblastoma 1.200 3.1e-03
juvenile dermatomyositis 1.058 1.3e-10
lung cancer -1.100 1.2e-02
lung carcinoma -1.400 4.5e-22
malignant mesothelioma 1.600 7.4e-04
medulloblastoma, large-cell 1.500 5.2e-05
osteosarcoma 1.078 9.4e-03
ovarian cancer -1.300 3.1e-05
primitive neuroectodermal tumor 1.400 4.8e-02
tuberculosis and treatment for 6 months 1.700 1.5e-05

Gene RIF (87)

AA Sequence

MAAAAGNRASSSGFPGARATSPEAGGGGGALKASSAPAAAAGLLREAGSGGRERADWRRRQLRKVRSVEL      1 - 70
DQLPEQPLFLAASPPASSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRGGAHLTESVAAPDSGASSPAA     71 - 140
AEPGEKRAPAAEPSPAAAPAGREMENKETLKGLHKMDDRPEERMIREKLKATCMPAWKHEWLERRNRRGP    141 - 210
VVVKPIPVKGDGSEMNHLAAESPGEVQASAASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQ    211 - 280
SGRITPPRRAPSPDGFSPYSPEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCA    281 - 350
RGTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT    351 - 420
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPL    421 - 490
CRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTVQQQPLAGSRRNQESNFNLTHYGTQQIPPAYKDLAEPW    491 - 560
IQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGESTGNSGGSSGSSPSGGATSGSSQTSISGD    561 - 630
VVEACCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLQPVVDTILVKCADANSRTSQ    631 - 700
LSISTLLELCKGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPA    701 - 770
EFYPHIVSTDVSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLEM    771 - 840
LSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASVPNNYLETTENSSPECTVHLEK    841 - 910
TGKGLCATKLSASSEDISERLASISVGPSSSTTTTTTTTEQPKPMVQTKGRPHSQCLNSSPLSHHSQLMF    911 - 980
PALSTPSSSTPSVPAGTATDVSKHRLQGFIPCRIPSASPQTQRKFSLQFHRNCPENKDSDKLSPVFTQSR    981 - 1050
PLPSSNIHRPKPSRPTPGNTSKQGDPSKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKC   1051 - 1120
RLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALA   1121 - 1190
IAMAMSASQDALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQA   1191 - 1260
QDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIEWMAGGS   1261 - 1330
VAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLASKGT   1331 - 1400
GAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTA   1401 - 1470
PSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW                               1471 - 1512
//

Text Mined References (133)

PMID Year Title