Property Summary

NCBI Gene PubMed Count 107
PubMed Score 391.79
PubTator Score 163.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.100 1.8e-04
hepatocellular carcinoma -2.000 1.2e-04
invasive ductal carcinoma -1.300 2.0e-04
lung cancer -1.200 1.3e-04
medulloblastoma, large-cell -1.300 6.5e-03
Multiple myeloma 1.398 4.4e-03
non-small cell lung cancer -1.201 2.0e-20
ovarian cancer -1.600 2.0e-07
primary pancreatic ductal adenocarcinoma 1.201 6.7e-03
spina bifida -1.082 4.9e-02

Protein-protein Interaction (2)

PDB (20)

Gene RIF (67)

AA Sequence

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR      1 - 70
LQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV                    71 - 125
//

Text Mined References (117)

PMID Year Title