Property Summary

NCBI Gene PubMed Count 45
PubMed Score 405.94
PubTator Score 170.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (24)

Disease log2 FC p
permanent atrial fibrillation -1.100 1.6e-02
psoriasis -2.400 1.1e-04
osteosarcoma 3.838 3.3e-07
medulloblastoma, large-cell 1.300 3.8e-04
autosomal dominant Emery-Dreifuss muscul... 1.309 5.0e-03
acute quadriplegic myopathy 1.338 5.3e-06
limb girdle muscular dystrophy 2A 1.008 3.4e-03
Atopic dermatitis -1.200 2.7e-04
primary pancreatic ductal adenocarcinoma 2.159 2.1e-04
non-small cell lung cancer 1.119 5.4e-05
intraductal papillary-mucinous adenoma (... -2.300 2.2e-03
intraductal papillary-mucinous carcinoma... -2.900 1.8e-03
intraductal papillary-mucinous neoplasm ... -1.300 4.5e-02
lung cancer 2.100 1.4e-02
colon cancer -1.300 7.2e-03
diabetes mellitus -1.200 2.4e-02
cystic fibrosis 1.800 6.1e-04
posterior fossa group B ependymoma -1.500 1.3e-06
lung carcinoma 3.300 6.3e-27
breast carcinoma -1.500 2.1e-25
Breast cancer -1.700 1.0e-05
gastric carcinoma 1.500 4.4e-02
ovarian cancer -2.200 1.5e-04
pancreatic cancer 1.800 4.1e-03

Gene RIF (17)

PMID Text
25902260 KIRREL3 interacting proteins MAP1B and MYO16 are potential candidates for intellectual disability and autism spectrum disorder.
25483588 The the MAP1B-LC1-mediated regulation most likely involves an internalization of the channels via a dynamin and clathrin-dependent pathway.
25429138 Localization of MAP1B is altered in amyotrophic lateral sclerosis spinal cords in a transgenic animal model.
24754922 Yeast-two-hybrid screening using human LRRK2 kinase domain as bait identified microtubule associated protein 1B (MAP1B) as a LRRK2 interactor.
24614691 signal transduction pathways downstream of 5-HT6R are regulated by MAP1B, which might play a role in 5-HT6R-mediated signaling in the brain.
24566975 An interaction between MAP1B LC1 and the ubiquitin-conjugating enzyme UBE2L3.
23333304 HIV-1 Vif downregulates the expression of microtubule-associated protein 1B (MAP1B) in Vif-expression T cells
21508097 We suggest a role for Stau2 in the generation and regulation of Map1b mRNA containing granules that are required for mGluR-long-term depression
20719958 These observations define a new and crucial function of MAP1B that is required for efficient cross-talk between microtubules and the actin cytoskeleton during neuronal polarization.
19567321 a new protein involved in the terminal differentiation of odontoblasts
19054571 Observational study of gene-disease association. (HuGE Navigator)
18656471 MAP1B light chain can interact with the tumor suppressor p53.
18195017 a role for MAP1B in DAPK-1-dependent signaling in autophagy and membrane blebbing.
18079022 Amyloid-beta 1-42 binds to a peptide comprising the microtubule binding domain of the heavy chain of microtubule-associated protein 1B by the screening of a human brain cDNA library expressed on M13 phage.
18063656 The light chain (LC1) of microtubule-associated protein 1B (MAP1B)-5-HT(3A) receptor interaction contributes to a mechanism that regulates receptor desensitization kinetics.
16996626 Complexes (MAP1B heavy chain-MAP1A light chain) form through interaction of homologous domains conserved in heavy and light chains of MAP1A and MAP1B. Conserved domains of the MAP1A and MAP1B light chains account for formation of light chain heterodimers.
12807913 MAP1B action is modulated by mapmodulin/leucine-rich acidic nuclear protein

AA Sequence

MATVVVEATEPEPSGSIANPAASTSPSLSHRFLDSKFYLLVVVGEIVTEEHLRRAIGNIELGIRSWDTNL      1 - 70
IECNLDQELKLFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAVSTEVRLMITDAARHKLLVLT     71 - 140
GQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHPANKASLTLFCPEEGDWKNSNLDRHNLQDFI    141 - 210
NIKLNSASILPEMEGLSEFTEYLSESVEVPSPFDILEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGF    211 - 280
NMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLI    281 - 350
SPDLGVVFLNVPENLKNPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKL    351 - 420
EMYVLNPVKSSKEMQYFMQQWTGTNKDKAEFILPNGQEVDLPISYLTSVSSLIVWHPANPAEKIIRVLFP    421 - 490
GNSTQYNILEGLEKLKHLDFLKQPLATQKDLTGQVPTPVVKQTKLKQRADSRESLKPAAKPLPSKSVRKE    491 - 560
SKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPIKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKP    561 - 630
KAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEKKEPKKEV    631 - 700
KKETPPKEVKKEVKKEEKKEVKKEEKEPKKEIKKLPKDAKKSSTPLSEAKKPAALKPKVPKKEESVKKDS    701 - 770
VAAGKPKEKGKIKVIKKEGKAAEAVAAAVGTGATTAAVMAAAGIAAIGPAKELEAERSLMSSPEDLTKDF    771 - 840
EELKAEEVDVTKDIKPQLELIEDEEKLKETEPVEAYVIQKEREVTKGPAESPDEGITTTEGEGECEQTPE    841 - 910
ELEPVEKQGVDDIEKFEDEGAGFEESSETGDYEEKAETEEAEEPEEDGEEHVCVSASKHSPTEDEESAKA    911 - 980
EADAYIREKRESVASGDDRAEEDMDEAIEKGEAEQSEEEADEEDKAEDAREEEYEPEKMEAEDYVMAVVD    981 - 1050
KAAEAGGAEEQYGFLTTPTKQLGAQSPGREPASSIHDETLPGGSESEATASDEENREDQPEEFTATSGYT   1051 - 1120
QSTIEISSEPTPMDEMSTPRDVMSDETNNEETESPSQEFVNITKYESSLYSQEYSKPADVTPLNGFSEGS   1121 - 1190
KTDATDGKDYNASASTISPPSSMEEDKFSRSALRDAYCSEVKASTTLDIKDSISAVSSEKVSPSKSPSLS   1191 - 1260
PSPPSPLEKTPLGERSVNFSLTPNEIKVSAEAEVAPVSPEVTQEVVEEHCASPEDKTLEVVSPSQSVTGS   1261 - 1330
AGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRS   1331 - 1400
PPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTSTSLYQDKQEGKSTDFAPIKE   1401 - 1470
DFGQEKKTDDVEAMSSQPALALDERKLGDVSPTQIDVSQFGSFKEDTKMSISEGTVSDKSATPVDEGVAE   1471 - 1540
DTYSHMEGVASVSTASVATSSFPEPTTDDVSPSLHAEVGSPHSTEVDDSLSVSVVQTPTTFQETEMSPSK   1541 - 1610
EECPRPMSISPPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEQSLAMDFSRQSPDHPTVGAGVLHIT   1611 - 1680
ENGPTEVDYSPSDMQDSSLSHKIPPMEEPSYTQDNDLSELISVSQVEASPSTSSAHTPSQIASPLQEDTL   1681 - 1750
SDVAPPRDMSLYASLTSEKVQSLEGEKLSPKSDISPLTPRESSPLYSPTFSDSTSAVKEKTATCHSSSSP   1751 - 1820
PIDAASAEPYGFRASVLFDTMQHHLALNRDLSTPGLEKDSGGKTPGDFSYAYQKPEETTRSPDEEDYDYE   1821 - 1890
SYEKTTRTSDVGGYYYEKIERTTKSPSDSGYSYETIGKTTKTPEDGDYSYEIIEKTTRTPEEGGYSYDIS   1891 - 1960
EKTTSPPEVSGYSYEKTERSRRLLDDISNGYDDSEDGGHTLGDPSYSYETTEKITSFPESEGYSYETSTK   1961 - 2030
TTRTPDTSTYCYETAEKITRTPQASTYSYETSDLCYTAEKKSPSEARQDVDLCLVSSCEYKHPKTELSPS   2031 - 2100
FINPNPLEWFASEEPTEESEKPLTQSGGAPPPPGGKQQGRQCDETPPTSVSESAPSQTDSDVPPETEECP   2101 - 2170
SITADANIDSEDESETIPTDKTVTYKHMDPPPAPVQDRSPSPRHPDVSMVDPEALAIEQNLGKALKKDLK   2171 - 2240
EKTKTKKPGTKTKSSSPVKKSDGKSKPLAASPKPAGLKESSDKVSRVASPKKKESVEKAAKPTTTPEVKA   2241 - 2310
ARGEEKDKETKNAANASASKSAKTATAGPGTTKTTKSSAVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRV   2311 - 2380
RSSYYVVSGNDPAAEEPSRAVLDALLEGKAQWGSNMQVTLIPTHDSEVMREWYQETHEKQQDLNIMVLAS   2381 - 2450
SSTVVMQDESFPACKIEL                                                       2451 - 2468
//

Text Mined References (61)

PMID Year Title
25902260 2015 Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment.
25483588 2014 The MAP1B-LC1/UBE2L3 complex catalyzes degradation of cell surface CaV2.2 channels.
25429138 2014 Futsch/MAP1B mRNA is a translational target of TDP-43 and is neuroprotective in a Drosophila model of amyotrophic lateral sclerosis.
24754922 2014 MAP1B rescues LRRK2 mutant-mediated cytotoxicity.
24614691 2014 Direct interaction and functional coupling between human 5-HT6 receptor and the light chain 1 subunit of the microtubule-associated protein 1B (MAP1B-LC1).
24566975 2014 CaV2.2 channel cell surface expression is regulated by the light chain 1 (LC1) of the microtubule-associated protein B (MAP1B) via UBE2L3-mediated ubiquitination and degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24089205 2013 Autophagy promotes primary ciliogenesis by removing OFD1 from centriolar satellites.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21508097 2011 Staufen 2 regulates mGluR long-term depression and Map1b mRNA distribution in hippocampal neurons.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20719958 2010 MAP1B regulates axonal development by modulating Rho-GTPase Rac1 activity.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19567321 2009 Microtubule-associated protein 1b, a neuronal marker involved in odontoblast differentiation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18656471 2008 Microtubule-associated protein 1B light chain (MAP1B-LC1) negatively regulates the activity of tumor suppressor p53 in neuroblastoma cells.
18419581 2008 MAP1 structural organization in Drosophila: in vivo analysis of FUTSCH reveals heavy- and light-chain subunits generated by proteolytic processing at a conserved cleavage site.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18195017 2008 DAPK-1 binding to a linear peptide motif in MAP1B stimulates autophagy and membrane blebbing.
18088087 2008 Phosphoproteome of resting human platelets.
18079022 2008 Amyloid-beta peptide binds to microtubule-associated protein 1B (MAP1B).
18063656 2008 Modulation of 5-HT3 receptor desensitization by the light chain of microtubule-associated protein 1B expressed in HEK 293 cells.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16996626 2006 Heterotypic complex formation between subunits of microtubule-associated proteins 1A and 1B is due to interaction of conserved domains.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16478718 2006 Interaction of PDZRhoGEF with microtubule-associated protein 1 light chains: link between microtubules, actin cytoskeleton, and neuronal polarity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16227972 2005 Gigaxonin-controlled degradation of MAP1B light chain is critical to neuronal survival.
16212419 Phosphoproteome analysis of HeLa cells using stable isotope labeling with amino acids in cell culture (SILAC).
15762842 2005 Binding of microtubule-associated protein 1B to LIS1 affects the interaction between dynein and LIS1.
15525354 2004 Cloning of a novel neuronally expressed orphan G-protein-coupled receptor which is up-regulated by erythropoietin, interacts with microtubule-associated protein 1b and colocalizes with the 5-hydroxytryptamine 2a receptor.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12807913 2003 Mapmodulin/leucine-rich acidic nuclear protein binds the light chain of microtubule-associated protein 1B and modulates neuritogenesis.
12689591 2003 JNK1 is required for maintenance of neuronal microtubules and controls phosphorylation of microtubule-associated proteins.
12684070 2003 Hmob3 brain-specific sequence is a part of phylogenetically conserved human MAP1B gene 3'-untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12147674 2002 Microtubule-associated protein 1B: a neuronal binding partner for gigaxonin.
11733546 2001 Microtubule-associated protein 1B: a neuronal binding partner for myelin-associated glycoprotein.
11102469 2000 GABAC receptor sensitivity is modulated by interaction with MAP1B.
11002287 2000 Regulation of microtubule-associated protein 1B (MAP1B) subunit composition.
10899930 2000 Evidence for expression of some microtubule-associated protein 1B in neurons as a plasma membrane glycoprotein.
10764738 2000 Microtubule-associated protein 1B is a component of cortical Lewy bodies and binds alpha-synuclein filaments.
9892354 1999 The protein MAP-1B links GABA(C) receptors to the cytoskeleton at retinal synapses.
9813091 1998 Novel features of the light chain of microtubule-associated protein MAP1B: microtubule stabilization, self interaction, actin filament binding, and regulation by the heavy chain.
9570753 1998 Inhibition of GSK-3beta leading to the loss of phosphorylated MAP-1B is an early event in axonal remodelling induced by WNT-7a or lithium.
9533556 1998 Decreased expression of microtubule-associated protein 5 (MAP5) in the molecular layer of cerebellum in preterm infants with olivocerebellar lesions.
7806212 1994 Cloning of human microtubule-associated protein 1B and the identification of a related gene on chromosome 15.
7519512 1994 Role of phosphorylated MAPlB in neuritogenesis.
2470876 1989 MAP 1A and MAP 1B are structurally related microtubule associated proteins with distinct developmental patterns in the CNS.
1881920 1991 Mapping of human microtubule-associated protein 1B in proximity to the spinal muscular atrophy locus at 5q13.
1712602 1991 MAP1B is encoded as a polyprotein that is processed to form a complex N-terminal microtubule-binding domain.