Property Summary

NCBI Gene PubMed Count 38
PubMed Score 104.78
PubTator Score 15.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 1.1e-06

Protein-protein Interaction (3)

Gene RIF (38)

PMID Text
26205822 Data show that HIV-1 env protein interacts with alpha-mannosidases ERManI (MAN1B1) and initiates endoplasmic reticulum (ER)-associated protein degradation (ERAD) pathway degradation process.
26205822 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
25411339 Results suggest that endoplasmic reticulum mannosidase I (ERManI) is turned over by an active autophagic process.
24566669 MAN1B1 deficiency appeared to be a frequent cause in our cohort of patients with unsolved congenital disorder of glycosylation type II.
24519966 The properties of ERMAN1 enable rapid selection of endoplasmic reticulum-associated degradation substrates in the endoplasmic reticulum.ERMAN1 digests mono-, di- and tri-glucosylated N-glycans.
24348268 we linked mutations in MAN1B1 to a Golgi glycosylation disorder. Additionally, our results support the recent findings on MAN1B1 localization
23940818 A novel post-transcriptional regulatory mechanism for ERManI via miR-125b and this molecule contributes to the regulation of carcinogenesis in hepatocellular carcinoma.
23427261 ERManI and gamma-COP contribute to a golgi-based quality control module that facilitates the retrieval of captured ERAD substrates back to the endoplasmic reticulum.
21763484 A homozygous nonsense mutation in MAN1B1 segregated with nonsyndromic autosomal-recessive intellectual disability and additional dysmorphic features.
21697506 Golgi localization of ERManI defines spatial separation of the mammalian glycoprotein quality control system
20643940 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
19739260 Observational study of gene-disease association. (HuGE Navigator)
19444872 the identified single-nucleotide polymorphism can accelerate the onset of the end-stage liver disease associated with alpha1-antitrypsin deficiency and underscore the contribution of biosynthetic quality control as a modifier of genetic disease
18619586 the true catalytic proton donor is Asp463 in the human endoplasmic reticulum alpha-(1-->2)-mannosidase I
18003979 ERManI is required for trimming to Man(5-6)GlcNAc(2) and for endoplasmic reticulum associated degradation in cells in vivo.
17727818 overexpression of Golgi alpha1,2-mannosidase IA, IB, and IC also accelerates ERAD of terminally misfolded human alpha1-antitrypsin variant null (Hong Kong) (NHK), and mannose trimming from the N-glycans on NHK in 293 cells
15785934 Increased activity of alpha-mannosidase in the peritoneal fluid is associated with gynecologic cancers and pelvic inflammatory disease
15713668 glycoside bond cleavage proceeds through a least motion conformational twist of a properly predisposed substrate
12815101 Modification by endoplasmic reticulum mannosidase I (ERManI) contributes to the preferential selection of the misfolded AAT monomer for proteasomal degradation.
12736254 ER processing alpha1,2-mannosidase (ER ManI) has a role in ER-associated degradation of misfolded proteins
12560567 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
11530211 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
9109416 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
8892864 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
8673525 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
8218172 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
8093218 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
3264072 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
3099781 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
2829950 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
2649653 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
2542563 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
2541446 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
2406237 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
2355006 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
2283726 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
2187500 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process
1736542 HIV-1 Env interacts with MAN1B1 (ERMan1) via the lumenal catalytic domain which inititates an edoplasmic reticulum (ER)- associated Env degradation process

AA Sequence

MAACEGRRSGALGSSQSDFLTPPVGGAPWAVATTVVMYPPPPPPPHRDFISVTLSFGENYDNSKSWRRRS      1 - 70
CWRKWKQLSRLQRNMILFLLAFLLFCGLLFYINLADHWKALAFRLEEEQKMRPEIAGLKPANPPVLPAPQ     71 - 140
KADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRG    141 - 210
AVIEPEQGTELPSRRAEVPTKPPLPPARTQGTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRS    211 - 280
FSEWFGLGLTLIDALDTMWILGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSL    281 - 350
FLRKAEDFGNRLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEA    351 - 420
VEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEA    421 - 490
IEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMN    491 - 560
RQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRF    561 - 630
TRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA     631 - 699
//

Text Mined References (38)

PMID Year Title
26205822 2015 ERManI (Endoplasmic Reticulum Class I ?-Mannosidase) Is Required for HIV-1 Envelope Glycoprotein Degradation via Endoplasmic Reticulum-associated Protein Degradation Pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25411339 2015 Mammalian ER mannosidase I resides in quality control vesicles, where it encounters its glycoprotein substrates.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24566669 2014 Diagnostic serum glycosylation profile in patients with intellectual disability as a result of MAN1B1 deficiency.
24519966 2014 Trimming of glucosylated N-glycans by human ER ?1,2-mannosidase I.
24348268 2013 MAN1B1 deficiency: an unexpected CDG-II.
23940818 2013 ERManI is a target of miR-125b and promotes transformation phenotypes in hepatocellular carcinoma (HCC).
23427261 2013 Golgi-situated endoplasmic reticulum ?-1, 2-mannosidase contributes to the retrieval of ERAD substrates through a direct interaction with ?-COP.
22160784 2012 In vitro mannose trimming property of human ER ?-1,2 mannosidase I.
21763484 2011 Mutations in the alpha 1,2-mannosidase gene, MAN1B1, cause autosomal-recessive intellectual disability.
21697506 2011 Golgi localization of ERManI defines spatial separation of the mammalian glycoprotein quality control system.
21062743 2011 Mannose trimming is required for delivery of a glycoprotein from EDEM1 to XTP3-B and to late endoplasmic reticulum-associated degradation steps.
19946888 2010 Defining the membrane proteome of NK cells.
19739260 2009 Polymorphism in the endoplasmic reticulum mannosidase I (MAN1B1) gene is not associated with liver disease in individuals homozygous for the Z variant of the alpha1-antitrypsin protease inhibitor (PiZZ individuals).
19444872 2009 Single nucleotide polymorphism-mediated translational suppression of endoplasmic reticulum mannosidase I modifies the onset of end-stage liver disease in alpha1-antitrypsin deficiency.
18619586 2008 Theory and computation show that Asp463 is the catalytic proton donor in human endoplasmic reticulum alpha-(1-->2)-mannosidase I.
18303019 2008 Getting in and out from calnexin/calreticulin cycles.
18003979 2008 Endoplasmic reticulum (ER) mannosidase I is compartmentalized and required for N-glycan trimming to Man5-6GlcNAc2 in glycoprotein ER-associated degradation.
17727818 2007 Stimulation of ERAD of misfolded null Hong Kong alpha1-antitrypsin by Golgi alpha1,2-mannosidases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15785934 2005 Increased activity of lysosomal enzymes in the peritoneal fluid of patients with gynecologic cancers and pelvic inflammatory disease.
15713668 2005 Mechanism of class 1 (glycosylhydrolase family 47) {alpha}-mannosidases involved in N-glycan processing and endoplasmic reticulum quality control.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12829701 2003 Endoplasmic reticulum-associated degradation of mammalian glycoproteins involves sugar chain trimming to Man6-5GlcNAc2.
12815101 2003 Elucidation of the molecular logic by which misfolded alpha 1-antitrypsin is preferentially selected for degradation.
12736254 2003 Enhancement of endoplasmic reticulum (ER) degradation of misfolded Null Hong Kong alpha1-antitrypsin by human ER mannosidase I.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12090241 2002 The specificity of the yeast and human class I ER alpha 1,2-mannosidases involved in ER quality control is not as strict previously reported.
10995765 2000 Structural basis for catalysis and inhibition of N-glycan processing class I alpha 1,2-mannosidases.
10521544 1999 Cloning and expression of a specific human alpha 1,2-mannosidase that trims Man9GlcNAc2 to Man8GlcNAc2 isomer B during N-glycan biosynthesis.
10409699 1999 Identification, expression, and characterization of a cDNA encoding human endoplasmic reticulum mannosidase I, the enzyme that catalyzes the first mannose trimming step in mammalian Asn-linked oligosaccharide biosynthesis.
9592125 1998 Molecular cloning, chromosomal mapping and tissue-specific expression of a novel human alpha1,2-mannosidase gene involved in N-glycan maturation.