Property Summary

NCBI Gene PubMed Count 46
PubMed Score 9.00
PubTator Score 43.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 4.0e-02
psoriasis -1.800 1.0e-03
posterior fossa group A ependymoma -2.900 1.1e-16
glioblastoma -2.300 4.9e-05
atypical teratoid / rhabdoid tumor -2.200 4.5e-04
medulloblastoma -1.300 2.4e-03
medulloblastoma, large-cell -1.800 6.1e-04
adrenocortical carcinoma 1.020 1.5e-03
non-small cell lung cancer -1.487 5.5e-19
intraductal papillary-mucinous adenoma (... 1.400 3.0e-04
intraductal papillary-mucinous carcinoma... 1.100 5.9e-03
lung adenocarcinoma -1.200 9.5e-18
adult high grade glioma -2.100 1.5e-05
pilocytic astrocytoma -1.900 1.1e-07
subependymal giant cell astrocytoma -1.976 1.1e-02
Breast cancer -1.600 9.6e-16
gastric carcinoma -1.200 4.9e-02
ductal carcinoma in situ -1.100 7.3e-03
invasive ductal carcinoma -1.700 2.1e-04
ovarian cancer -1.500 3.8e-06
pituitary cancer 1.100 4.1e-02

Gene RIF (21)

PMID Text
25993607 MAGI1 rs35855737 is a novel locus for neuroticism. [Meta-Analysis]
25990289 A deletion at ADAMTS9-MAGI1 locus is associated with psoriatic arthritis risk.
25557950 Variants in MAGI1 were associated with a Crohn's disease phenotype involving a complicated stricturing disease course.
22911767 The data suggests that inactivation of MAGI-1 by the NS1 protein from avian influenza A virus elicits an interferon-beta induction signal.
22718816 The PDZ1 and PDZ3 domains of MAGI-1 regulate the eight-exon isoform of the CXADR-like membrane protein.
22381734 Results presented herein provide further evidence for a role of MAGI1 in bipolar affective disorder and schizophrenia etiology.
21942217 MAGI1 expression is decreased in hepatocellular carcinoma, which correlates with poor prognosis, suggesting MAGI1 as a novel prognostic marker
21685691 MAGI1 may inhibit the cancer cell migration and invasion of hepatocellular carcinoma via regulating PTEN.
21489588 HPV16 E6 association with PDZ domain-containing proteins, MAGI1, Dlg1 or Scrib, stabilized the levels of E6.
21238461 Mutations designed in the C-terminal flanking region of the human MAGI-1 PDZ domain resulted in a significant decrease in binding affinity for human papillomavirus E6 peptides.
21123374 These results demonstrate that oncogenic HPV E6 proteins disrupt cellular tight junctions through the degradation of MAGI-1.
21070662 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20562105 Data conclude that the up-regulation of sdk-1 in podocytes is an important pathogenic factor in glomerulosclerosis and that the mechanism involves disruption of the actin cytoskeleton possibly via alterations in MAGI-1 function.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18562638 Structural basis for controlling the dimerization and stability of the WW domains of MAGI1 is reported.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17191119 MAGI-1 cleavage appears to be an important step in the disassembly of cell-cell contacts during apoptosis.
16339077 MAGI-1 is important for vascular endothelial-cadherin-dependent Rap1 activation upon cell-cell contact.
16019084 In vitro binding assays using the partial cDNA as a GST fusion protein confirm the binding to full-length MAGI-1 expressed in HEK293 cells.
15908431 Dll1 is presented on the surface of AJs formed at the apical termini of processes through interaction with MAGI1 to activate Notch on neighboring cells in the developing central nervous system
12042308 interaction with synaptopodin and alpha-actinin-4

AA Sequence

MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELL      1 - 70
LEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRFQKGSPDHELQQTIRDNLYRH     71 - 140
AVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVGTYEGNYYGTPKPPSQPVSGKVITTDALHSL    141 - 210
QSGSKQSTPKRTKSYNDMQNAGIVHAENEEEDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPI    211 - 280
TDPSQKFPQYLPLSAEDNLGPLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGV    281 - 350
HTEELDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQ    351 - 420
QTEEWTEDHSALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGD    421 - 490
EPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPF    491 - 560
DPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTGKVNGMKDARPSSPADVASNSSHGYPNDTVS    561 - 630
LASSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHN    631 - 700
QVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEF    701 - 770
PPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQ    771 - 840
DIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQ    841 - 910
AAKQGHVNLTVRRKVVFAVPKTENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIG    911 - 980
SGGGGGSGVVSTVVQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFAGNACVAMPHKIGRIIEGSPADRC    981 - 1050
GKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQ   1051 - 1120
GTQETRNTTKPKQESQFEFKAPQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERC   1121 - 1190
GKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYDPSSDRHGPATGPQGVPEVR   1191 - 1260
AGPDRRQHPSLESSYPPDLHKSSPHGEKRAHARDPKGSREYSRQPNEHHTWNGTSRKPDSGACRPKDRAP   1261 - 1330
EGRRDAQAERAAAANGPKRRSPEKRREGTRSADNTLERREKHEKRRDVSPERRRERSPTRRRDGSPSRRR   1331 - 1400
RSLERLLEQRRSPERRRGGSPERRAKSTDRRRARSPERRRERSLDKRNREDRASHREREEANLKQDAGRS   1401 - 1470
SRHPPEQRRRPYKECSTDLSI                                                    1471 - 1491
//

Text Mined References (53)

PMID Year Title
25993607 2015 Meta-analysis of Genome-wide Association Studies for Neuroticism, and the Polygenic Association With Major Depressive Disorder.
25990289 2015 A deletion at ADAMTS9-MAGI1 locus is associated with psoriatic arthritis risk.
25557950 2015 Identification of risk loci for Crohn's disease phenotypes using a genome-wide association study.
24561201 2014 Mislocalization of K+ channels causes the renal salt wasting in EAST/SeSAME syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22911767 2012 Regulation of interferon-? by MAGI-1 and its interaction with influenza A virus NS1 protein with ESEV PBM.
22718816 2012 The PDZ1 and PDZ3 domains of MAGI-1 regulate the eight-exon isoform of the coxsackievirus and adenovirus receptor.
22662192 2012 IQGAP1 interacts with components of the slit diaphragm complex in podocytes and is involved in podocyte migration and permeability in vitro.
22381734 2012 MAGI1 copy number variation in bipolar affective disorder and schizophrenia.
22166940 2012 A genome-wide study reveals rare CNVs exclusive to extreme phenotypes of Alzheimer disease.
21942217 2012 Downregulation of MAGI1 associates with poor prognosis of hepatocellular carcinoma.
21685691 2011 MAGI1 inhibits cancer cell migration and invasion of hepatocellular carcinoma via regulating PTEN.
21489588 2011 Stabilization of HPV16 E6 protein by PDZ proteins, and potential implications for genome maintenance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21238461 2011 The structural and dynamic response of MAGI-1 PDZ1 with noncanonical domain boundaries to the binding of human papillomavirus E6.
21123374 2011 A systematic analysis of human papillomavirus (HPV) E6 PDZ substrates identifies MAGI-1 as a major target of HPV type 16 (HPV-16) and HPV-18 whose loss accompanies disruption of tight junctions.
21070662 2010 Schizophrenia and vitamin D related genes could have been subject to latitude-driven adaptation.
20562105 2010 Up-regulation of the homophilic adhesion molecule sidekick-1 in podocytes contributes to glomerulosclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18562638 2008 Structural basis for controlling the dimerization and stability of the WW domains of an atypical subfamily.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17267502 2007 Structures of a human papillomavirus (HPV) E6 polypeptide bound to MAGUK proteins: mechanisms of targeting tumor suppressors by a high-risk HPV oncoprotein.
17191119 2007 Cleavage of MAGI-1, a tight junction PDZ protein, by caspases is an important step for cell-cell detachment in apoptosis.
16751601 2006 CIN85 is localized at synapses and forms a complex with S-SCAM via dendrin.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16464232 2006 Postsynaptic recruitment of Dendrin depends on both dendritic mRNA transport and synaptic anchoring.
16339077 2006 MAGI-1 is required for Rap1 activation upon cell-cell contact and for enhancement of vascular endothelial cadherin-mediated cell adhesion.
16316992 2006 Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins.
16043488 2005 Angiomotin regulates endothelial cell-cell junctions and cell motility.
16019084 2005 Identification and characterization of a novel tight junction-associated family of proteins that interacts with a WW domain of MAGI-1.
15908431 2005 MAGI1 recruits Dll1 to cadherin-based adherens junctions and stabilizes it on the cell surface.
15317815 2004 PSD-95 and Lin-7b interact with acid-sensing ion channel-3 and have opposite effects on H+- gated current.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627983 2003 Carom: a novel membrane-associated guanylate kinase-interacting protein with two SH3 domains.
12773569 2003 JAM4, a junctional cell adhesion molecule interacting with a tight junction protein, MAGI-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444549 2002 Chimaeric HPV E6 proteins allow dissection of the proteolytic pathways regulating different E6 cellular target proteins.
12097473 2002 Association of the kinesin superfamily motor protein KIF1Balpha with postsynaptic density-95 (PSD-95), synapse-associated protein-97, and synaptic scaffolding molecule PSD-95/discs large/zona occludens-1 proteins.
12042308 2002 Interaction of two actin-binding proteins, synaptopodin and alpha-actinin-4, with the tight junction protein MAGI-1.
11969287 2002 MAGI-1: a widely expressed, alternatively spliced tight junction protein.
11571640 2001 HPV E6 and MAGUK protein interactions: determination of the molecular basis for specific protein recognition and degradation.
11274227 2001 The membrane-associated guanylate kinase protein MAGI-1 binds megalin and is present in glomerular podocytes.
11168587 2000 Membrane-associated guanylate kinase with inverted orientation (MAGI)-1/brain angiogenesis inhibitor 1-associated protein (BAP1) as a scaffolding molecule for Rap small G protein GDP/GTP exchange protein at tight junctions.
9647739 1998 Cloning and characterization of BAI-associated protein 1: a PDZ domain-containing protein that interacts with BAI1.
9647693 1998 Atrophin-1, the DRPLA gene product, interacts with two families of WW domain-containing proteins.
9395497 1997 MAGI-1, a membrane-associated guanylate kinase with a unique arrangement of protein-protein interaction domains.
9225980 1997 cDNAs with long CAG trinucleotide repeats from human brain.
9169421 1997 Identification of novel human WW domain-containing proteins by cloning of ligand targets.