Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.39
PubTator Score 0.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung cancer 2890 4.7e-18
malignant mesothelioma 3232 4.6e-07
osteosarcoma 7950 9.2e-04
lung cancer 4740 3.4e-03

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.100 3.4e-03
malignant mesothelioma 2.100 4.6e-07
non-small cell lung cancer 1.080 4.7e-18
osteosarcoma 1.130 9.2e-04

Synonym

Accession Q9HAY2 Q9H215
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKALARR      1 - 70
RAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKH     71 - 140
HTYILINKLKPLEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYP    141 - 210
KRLIMEDFVQQRYLSYRRVPHTNPPEYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADE    211 - 280
ADRARAKARAEASMRARASARAGIHLW                                               281 - 307
//

Text Mined References (10)

PMID Year Title