Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.77
PubTator Score 0.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.7e-18
malignant mesothelioma 3163 4.6e-07
lung cancer 4473 9.0e-05
osteosarcoma 7933 9.2e-04

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.100 4.6e-07
osteosarcoma 1.130 9.2e-04
non-small cell lung cancer 1.080 4.7e-18
lung cancer 1.400 9.0e-05

Synonym

Accession Q9HAY2 Q9H215
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKALARR      1 - 70
RAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKH     71 - 140
HTYILINKLKPLEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYP    141 - 210
KRLIMEDFVQQRYLSYRRVPHTNPPEYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADE    211 - 280
ADRARAKARAEASMRARASARAGIHLW                                               281 - 307
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11454705 2001 An overview of the MAGE gene family with the identification of all human members of the family.
11313144 2001 MAGE-F1, a novel ubiquitously expressed member of the MAGE superfamily.