Property Summary

NCBI Gene PubMed Count 76
PubMed Score 306.85
PubTator Score 275.49

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 5.282 2.6


Accession P43357 Q6FHI6
Symbols HIP8


PANTHER Protein Class (1)


1QEW   5BRZ   4V0P  

Gene RIF (61)

AA Sequence

TSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE                                        281 - 314

Text Mined References (79)

PMID Year Title