Property Summary

NCBI Gene PubMed Count 76
PubMed Score 306.85
PubTator Score 275.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2388 5.282 2.6

Synonym

Accession P43357 Q6FHI6
Symbols HIP8
HYPD
CT1.3
MAGE3
MAGEA6

Gene

PANTHER Protein Class (1)

PDB

1QEW   5BRZ   4V0P  

Gene RIF (61)

AA Sequence

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS      1 - 70
LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVV     71 - 140
GNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIA    141 - 210
REGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVE    211 - 280
TSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE                                        281 - 314
//

Text Mined References (79)

PMID Year Title