Property Summary

NCBI Gene PubMed Count 20
PubMed Score 20.26
PubTator Score 17.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 2.5e-08
non-small cell lung cancer 2798 7.7e-06
malignant mesothelioma 3163 1.7e-05
Disease Target Count Z-score Confidence
Melanoma 261 3.737 1.9

Gene RIF (5)

PMID Text
23950870 Data show the Differences in high resolution melting analysis in promoters of tumor markers neuronal membrane glycoprotein M6-B, melanoma antigen family A12 and immunoglobulin superfamily Fc receptor indicated invasiveness of hepatocellular carcinoma.
22707303 To identify novel CTL epitopes from MAGE-A6 and MAGE-A12 antigens.
18197853 Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma
18057533 results of this study may indicate Melanoma associated-A12 antigen(MAGE-A12)as a diagnostic marker for early detection of oral squamous cell carcinoma
17634428 These data show, for the first time, the involvement of methyl-CpG binding domain proteins in the regulation of the MAGE-A genes.

AA Sequence

MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETASSSSTLVEVTLREVPAAESPSPPHSPQGAST      1 - 70
LPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVI     71 - 140
RNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYILVTCLGLSYDGLLGDNQIVPKTGLLIIVLAIIA    141 - 210
KEGDCAPEEKIWEELSVLEASDGREDSVFAHPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVE    211 - 280
TSYVKVLHHLLKISGGPHISYPPLHEWAFREGEE                                        281 - 314
//

Text Mined References (23)

PMID Year Title
23950870 2013 Discovery and validation of DNA hypomethylation biomarkers for liver cancer using HRM-specific probes.
23574628 2013 Preferential expression of cancer/testis genes in cancer stem-like cells: proposal of a novel sub-category, cancer/testis/stem gene.
23090077 Characterization of T-cell receptors directed against HLA-A*01-restricted and C*07-restricted epitopes of MAGE-A3 and MAGE-A12.
22707303 2012 Identification of novel MAGE-A6- and MAGE-A12-derived HLA-A24-restricted cytotoxic T lymphocyte epitopes using an in silico peptide-docking assay.
18197853 2008 Expression of melanoma-associated antigens in oral squamous cell carcinoma.
18057533 2008 Expression of MAGE-A12 in oral squamous cell carcinoma.
17942928 2007 MAGE-A, mMage-b, and MAGE-C proteins form complexes with KAP1 and suppress p53-dependent apoptosis in MAGE-positive cell lines.
17634428 2007 Methyl-CpG binding domain proteins and their involvement in the regulation of the MAGE-A1, MAGE-A2, MAGE-A3, and MAGE-A12 gene promoters.
16687489 2006 Promoter demethylation and histone acetylation mediate gene expression of MAGE-A1, -A2, -A3, and -A12 in human cancer cells.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12673681 2003 Clinical and immunological evaluation of patients with metastatic melanoma undergoing immunization with the HLA-Cw*0702-associated epitope MAGE-A12:170-178.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077290 2002 Generation of CTL recognizing an HLA-A*0201-restricted epitope shared by MAGE-A1, -A2, -A3, -A4, -A6, -A10, and -A12 tumor antigens: implication in a broad-spectrum tumor immunotherapy.
11750719 2002 Expression of MAGE-12 in lung cancer.
10890380 2000 MAGE-12 and MAGE-6 are frequently expressed in malignant melanoma.
10854409 2000 Comparative genome sequence analysis of the Bpa/Str region in mouse and Man.
10820289 2000 Cytolytic T lymphocytes raised against a human bladder carcinoma recognize an antigen encoded by gene MAGE-A12.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8575766 1995 The melanoma antigen gene (MAGE) family is clustered in the chromosomal band Xq28.
8276455 1994 Sequence and expression pattern of the human MAGE2 gene.
8037761 1994 Cloning and analysis of MAGE-1-related genes.
7927540 1994 Structure, chromosomal localization, and expression of 12 genes of the MAGE family.