Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.68
PubTator Score 1.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
non-small cell lung cancer 1.852 7.3e-14
intraductal papillary-mucinous adenoma (... 2.200 2.9e-05
Hydrolethalus syndrome 2.028 4.5e-02
active Crohn's disease 1.072 2.4e-02
fibroadenoma 1.200 7.2e-03
interstitial cystitis -2.800 3.4e-05
group 3 medulloblastoma -1.400 5.3e-03
ovarian cancer 2.200 1.9e-05
pituitary cancer 1.900 1.8e-03
chronic rhinosinusitis -1.045 4.7e-03
psoriasis -1.200 2.2e-52

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18360792 LYPD7 was especially highly expressed in testis, lung, stomach, and prostate.

AA Sequence

MLYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNSFKCFTCENAGD      1 - 70
NYNCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGCHHSRDSEHTECRSCCEGMIC     71 - 140
NVELPTNHTNAVFAVMHAQRTSGSSAPTLYLPVLAWVFVLPLL                               141 - 183
//

Text Mined References (6)

PMID Year Title
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18360792 2009 Cloning and characterization of a human LYPD7, a new member of the Ly-6 superfamily.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.