Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.38
PubTator Score 19.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.200 3.5e-03
ependymoma -1.700 4.1e-15
glioblastoma -1.800 3.6e-09
oligodendroglioma -1.100 2.9e-14
osteosarcoma 1.462 2.5e-05
group 3 medulloblastoma -2.900 1.4e-07
atypical teratoid/rhabdoid tumor -2.300 2.0e-13
medulloblastoma, large-cell -2.800 1.9e-06
primitive neuroectodermal tumor -2.400 9.0e-06
pancreatic ductal adenocarcinoma liver m... -1.036 2.1e-03
pediatric high grade glioma -1.900 2.0e-08
pilocytic astrocytoma -1.500 8.8e-08
psoriasis 2.000 1.4e-10
ovarian cancer 1.800 9.4e-08
head and neck cancer and chronic obstruc... 1.300 3.8e-03

Gene RIF (13)

PMID Text
26033490 These findings provide new insights into the acetylcholine receptor-mediated regulatory mechanism of SLURP-2 expression in keratinocytes.
26025503 These studies suggest that lynx1 is a potential target both for development of drugs that may limit lung cancer growth as well as for drugs that may be effective for asthma or COPD treatment.
25571874 This epigenome-wide DNA methylation analysis in postmortem hippocampus and prefrontal cortex specimens confirmed LYNX1 DNA methylation profiles in major depression.
24877120 SLURP-2 downregulated TNFalpha and IFNgamma R in T-cells and reduced IL-6 production by macrophage
23585571 Micromolar affinities and fast washout rates measured for ws-LYNX1 and its mutants are in contrast to nanomolar affinities and irreversibility of binding for alpha-bungarotoxin and similar snake alpha-neurotoxins also targeting alpha7 nAChR.
21252236 Computer modeling, based on ws-LYNX1 NMR structure and AChBP x-ray structure, revealed a possible mode of ws-LYNX1 binding.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19639180 LY-6K meaningfully participates in breast cancer cell metastasis
18559515 decreased Lynx1 is associated with squamous cell lung carcinoma
17643396 anti-tumorigenic activities of SLURP-1 and -2 were demonstrated both in vitro and in vivo.
17089039 LY-6K,a novel member protein of the Ly-6/uPAR superfamily, is a significant new molecular marker for diagnosis and gene therapy in patients with breast cancer.
16575903 These results indicated that SLURP-2 competes with acetylcholine predominantly at the alpha3 nAChR, and that receptor ligation with SLURP-2 delays keratinocyte differentiation and prevents apoptosis.
12573258 Up-regulated in psoriasis vulgaris.

AA Sequence

MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSH      1 - 70
GSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD              71 - 131
//

Text Mined References (20)

PMID Year Title
27098205 2016 Organization, evolution and functions of the human and mouse Ly6/uPAR family genes.
26033490 2015 Transcriptional regulation of SLURP2, a psoriasis-associated gene, is under control of IL-22 in the skin: A special reference to the nested gene LYNX1.
26025503 2015 Role of Lynx1 and related Ly6 proteins as modulators of cholinergic signaling in normal and neoplastic bronchial epithelium.
25571874 2015 Aberrant NMDA receptor DNA methylation detected by epigenome-wide analysis of hippocampus and prefrontal cortex in major depression.
24877120 2014 Anti-inflammatory effects of the nicotinergic peptides SLURP-1 and SLURP-2 on human intestinal epithelial cells and immunocytes.
23585571 2013 Water-soluble LYNX1 residues important for interaction with muscle-type and/or neuronal nicotinic receptors.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21252236 2011 NMR structure and action on nicotinic acetylcholine receptors of water-soluble domain of human LYNX1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19639180 2009 Metastatic effect of LY-6K gene in breast cancer cells.
18559515 2008 Activated cholinergic signaling provides a target in squamous cell lung carcinoma.
17643396 2007 Overexpression of SLURP-1 and -2 alleviates the tumorigenic action of tobacco-derived nitrosamine on immortalized oral epithelial cells.
17089039 2006 LY-6K gene: a novel molecular marker for human breast cancer.
16575903 2006 SLURP-2: A novel cholinergic signaling peptide in human mucocutaneous epithelium.
16421571 2006 DNA sequence and analysis of human chromosome 8.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12573258 2003 SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10402197 1999 lynx1, an endogenous toxin-like modulator of nicotinic acetylcholine receptors in the mammalian CNS.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.