Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.54
PubTator Score 19.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.800 1.4e-06
astrocytic glioma -1.200 3.5e-03
Astrocytoma, Pilocytic -1.500 6.3e-08
atypical teratoid / rhabdoid tumor -2.200 6.0e-12
ependymoma -1.500 6.3e-03
glioblastoma -1.800 3.6e-09
group 3 medulloblastoma -1.300 4.7e-04
head and neck cancer and chronic obstruc... 1.300 3.8e-03
medulloblastoma, large-cell -2.800 1.9e-06
oligodendroglioma -1.100 2.9e-14
osteosarcoma 1.042 1.6e-04
ovarian cancer 1.800 9.4e-08
pancreatic ductal adenocarcinoma liver m... -1.036 2.1e-03
primitive neuroectodermal tumor -2.400 9.0e-06
psoriasis 1.400 5.3e-25

Gene RIF (10)

AA Sequence

MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKVSKSCVPRCFE      1 - 70
TVYDGYSKHASTTSCCQYDLCNGTGLATPATLALAPILLATLWGLL                             71 - 116
//

Text Mined References (19)

PMID Year Title