Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.76
PubTator Score 3.57

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -2.800 8.9e-04
oligodendroglioma -2.200 9.5e-14
glioblastoma -2.900 3.9e-03
ependymoma 1.300 4.4e-03
medulloblastoma -3.100 3.2e-05
atypical teratoid / rhabdoid tumor -1.900 2.9e-02
medulloblastoma, large-cell -4.300 1.3e-04
adult high grade glioma -2.200 1.4e-02
Pick disease -1.500 4.4e-02
pituitary cancer 1.900 1.8e-04

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVN      1 - 70
KMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP     71 - 140
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9799603 1998 Isolation and characterization of a new member of the human Ly6 gene family (LY6H).
3028776 1986 Isolation of a murine Ly-6 cDNA reveals a new multigene family.