Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.88
PubTator Score 3.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.200 1.4e-02
astrocytic glioma -1.900 1.7e-02
atypical teratoid / rhabdoid tumor -1.900 2.9e-02
ependymoma 1.300 4.4e-03
glioblastoma -2.000 3.4e-03
group 4 medulloblastoma -1.900 2.9e-02
medulloblastoma, large-cell -4.300 1.3e-04
oligodendroglioma -1.600 4.7e-02
Pick disease -1.500 4.4e-02
pituitary cancer 1.900 1.8e-04

Gene RIF (1)

AA Sequence

MLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVN      1 - 70
KMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP     71 - 140
//

Text Mined References (9)

PMID Year Title