Property Summary

Ligand Count 8
NCBI Gene PubMed Count 49
PubMed Score 77.05
PubTator Score 61.52

Knowledge Summary

Patent (9,228)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.1e-109
Disease Target Count Z-score Confidence
Asthma 385 3.985 2.0
Trichomoniasis 10 3.207 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 1.1e-109

Gene RIF (39)

AA Sequence

MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNG      1 - 70
FVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASV     71 - 140
LLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAA    141 - 210
AHLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAV    211 - 280
AALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGR    281 - 350
SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL                                   351 - 389
//

Text Mined References (50)

PMID Year Title