Property Summary

NCBI Gene PubMed Count 59
PubMed Score 76.88
PubTator Score 72.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.100 9.3e-04
osteosarcoma -1.319 2.3e-02
lung cancer -1.400 2.3e-03
fibroadenoma -1.500 3.0e-03
pilocytic astrocytoma 1.200 5.3e-03
COPD -1.100 3.5e-03
cystic fibrosis and chronic rhinosinusit... 1.073 2.4e-02

Gene RIF (35)

PMID Text
26554018 the importance of LSP1 Copy number variations and LSP1 insufficiency in the pathogenesis of rheumatoid arthritis, is reported.
26191300 LSP1 rs569550 and rs592373 polymorphisms are both risk factors for breast cancer.
24681604 The breast cancer SNP LSP1 rs3817198 was associated with an increased risk of lung cancer (odds ratio: 1.10) This association was strongest for women with adenocarcinoma (P = 1.2x10(-4)).
24162774 HIV-1 gp120 upregulates the expression of lymphocyte-specific protein 1 (LSP1) in human B cells
23119100 Data indicate that slit2N alters the localization and binding of Robo1 to WASp and LSP1 in HIV-1-gp120-treated immature dendritic cells (iDCs).
23119100 HIV-1 gp120 upregulates the expression of lymphocyte-specific protein 1 (LSP1) in human B cells
22454379 Single nucleotide polymorphism in LSP1 is associated with breast cancer.
21127985 The LSP1 rs3817198T>C polymorphism is a low-penetrant risk factor for developing breast cancer but may not be in Africans.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20605201 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20554749 Observational study of gene-disease association. (HuGE Navigator)
20453838 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20417875 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20145138 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20054709 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19856316 Low-risk variants of LSP1 is associated with familial breast cancer.
19843670 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19789366 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19718030 DC-SIGN was constitutively associated with a signalosome complex consisting of the scaffold proteins LSP1, KSR1 and CNK and the kinase Raf-1
19700666 HIV-1 gp120 upregulates the expression of lymphocyte-specific protein 1 (LSP1) in human B cells
19656774 The LSP1 and 2q35 SNPs appear to interact multiplicatively on breast cancer risk for BRCA2 mutation carriers.
19656774 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19232126 Observational study of gene-disease association. (HuGE Navigator)
19094228 Observational study of gene-disease association. (HuGE Navigator)
18973230 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18437204 Meta-analysis of gene-disease association. (HuGE Navigator)
17997823 Observational study of gene-disease association. (HuGE Navigator)
17827388 Observational study of gene-disease association. (HuGE Navigator)
17481585 MK2-regulated LSP1 phosphorylation is involved in stabilization of F-actin polarization during neutrophil chemotaxis.
17296787 LSP1 protein facilitates virus transport into the proteasome after its interaction with DC-SIGN through its interaction with cytoskeletal proteins.
15090600 Leukocyte-specific protein 1 is a cytoskeletal targeting protein for the ERK/MAP kinase pathway
12972289 LSP1 interacts with F-actin and the cytoskeleton through residues downstream of amino acid residue 230. The cytoskeleton binding site of mouse LSP1 maps to the 300-330 interval.

AA Sequence

MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPS      1 - 70
EAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSL     71 - 140
SKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIE    141 - 210
KSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKT    211 - 280
PSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP               281 - 339
//

Text Mined References (66)

PMID Year Title
26554018 2015 Leukocyte-specific protein 1 regulates T-cell migration in rheumatoid arthritis.
26191300 2015 Correlation between LSP1 polymorphisms and the susceptibility to breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
24681604 2014 Pleiotropic associations of risk variants identified for other cancers with lung cancer risk: the PAGE and TRICL consortia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23119100 2012 Slit2N/Robo1 inhibit HIV-gp120-induced migration and podosome formation in immature dendritic cells by sequestering LSP1 and WASp.
22454379 2012 Common breast cancer susceptibility variants in LSP1 and RAD51L1 are associated with mammographic density measures that predict breast cancer risk.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21269460 2011 Initial characterization of the human central proteome.
21127985 2011 Association of a LSP1 gene rs3817198T>C polymorphism with breast cancer risk: evidence from 33,920 cases and 35,671 controls.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20605201 2010 Gene-environment interactions in 7610 women with breast cancer: prospective evidence from the Million Women Study.
20554749 2010 FGFR2 and other loci identified in genome-wide association studies are associated with breast cancer in African-American and younger women.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20453838 2010 Genome-wide association study identifies five new breast cancer susceptibility loci.
20417875 2010 Distribution of FGFR2, TNRC9, MAP3K1, LSP1, and 8q24 alleles in genetically enriched breast cancer patients versus elderly tumor-free women.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20145138 2010 Common genetic variants associated with breast cancer and mammographic density measures that predict disease.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
20054709 2010 Birth weight, breast cancer susceptibility loci, and breast cancer risk.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19856316 2010 Low-risk variants FGFR2, TNRC9 and LSP1 in German familial breast cancer patients.
19843670 2009 Association of breast cancer susceptibility variants with risk of pancreatic cancer.
19789366 2009 Evaluation of 11 breast cancer susceptibility loci in African-American women.
19718030 2009 Carbohydrate-specific signaling through the DC-SIGN signalosome tailors immunity to Mycobacterium tuberculosis, HIV-1 and Helicobacter pylori.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19656774 2009 Common variants in LSP1, 2q35 and 8q24 and breast cancer risk for BRCA1 and BRCA2 mutation carriers.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19232126 2009 Association between breast cancer susceptibility loci and mammographic density: the Multiethnic Cohort.
19094228 2008 The influence of genetic variation in 30 selected genes on the clinical characteristics of early onset breast cancer.
18973230 2009 Breast cancer susceptibility alleles and ovarian cancer risk in 2 study populations.
18437204 2008 Heterogeneity of breast cancer associations with five susceptibility loci by clinical and pathological characteristics.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17997823 2007 Clinical correlates of low-risk variants in FGFR2, TNRC9, MAP3K1, LSP1 and 8q24 in a Dutch cohort of incident breast cancer cases.
17827388 2007 Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma.
17529967 2007 Genome-wide association study identifies novel breast cancer susceptibility loci.
17481585 2007 MAPKAPK2-mediated LSP1 phosphorylation and FMLP-induced neutrophil polarization.
17296787 2007 Leukocyte-specific protein 1 interacts with DC-SIGN and mediates transport of HIV to the proteasome in dendritic cells.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
15090600 2004 Leukocyte-specific protein 1 targets the ERK/MAP kinase scaffold protein KSR and MEK1 and ERK2 to the actin cytoskeleton.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972289 2003 A cell-free binding assay maps the LSP1 cytoskeletal binding site to the COOH-terminal 30 amino acids.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11746662 2001 Hair-forming activity of human lymphocyte specific protein 1 requires cooperation between its caldesmon-like domains and the villin headpiece-like domains.
10925289 2000 Human lymphocyte-specific protein 1, the protein overexpressed in neutrophil actin dysfunction with 47-kDa and 89-kDa protein abnormalities (NAD 47/89), has multiple F-actin binding domains.
10233704 1999 Lymphocyte-specific protein 1: a specific marker of human leucocytes.
9890705 1998 Developmental regulation of lymphocyte-specific protein 1 (LSP1) expression in thymus during human T-cell maturation.
8995217 1997 LSP1 is the major substrate for mitogen-activated protein kinase-activated protein kinase 2 in human neutrophils.
8838798 1996 Alternatively spliced exons encode the tissue-specific 5' termini of leukocyte pp52 and stromal cell S37 mRNA isoforms.
8468046 1993 Human lymphocyte-specific pp52 gene is a member of a highly conserved dispersed family.
8274738 1994 The 47-kD protein increased in neutrophil actin dysfunction with 47- and 89-kD protein abnormalities is lymphocyte-specific protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7706408 1994 Expression of mouse LSP1/S37 isoforms. S37 is expressed in embryonic mesenchymal cells.
7561054 1995 The actin-binding protein, lymphocyte-specific protein 1, is expressed in human leukocytes and human myeloid and lymphoid cell lines.
2674678 1989 Lymphocyte-specific Ca2+-binding protein LSP1 is associated with the cytoplasmic face of the plasma membrane.
2295815 1990 Human and mouse LSP1 genes code for highly conserved phosphoproteins.
2174784 1990 Molecular cloning and characterization of WP34, a phosphorylated human lymphocyte differentiation and activation antigen.