Leucine-rich single-pass membrane protein 1

Property Summary

NCBI Gene PubMed Count	6
PubMed Score	0.00

Knowledge Summary

Patent

No data available

TINX Plot

Disease (1)

Expression Atlas

Disease	Target Count	P-value
acute quadriplegic myopathy	1158	9.6e-06
osteosarcoma	7950	1.6e-04

Expression

Specificity
Differential

Differential Expression (2)

Disease	log2 FC	p
acute quadriplegic myopathy	-1.520	9.6e-06
osteosarcoma	-1.410	1.6e-04

Muscle - Skeletal 17,778

Artery - Aorta 17,896

Brain - Cerebellar Hemisphere 18,015

Lung 18,057

Brain - Cerebellum 17,983

Testis 18,518

Artery - Coronary 17,949

Artery - Tibial 17,631

Whole Blood 17,439

Prostate 18,213

Spleen 17,614

Uterus 17,618

Small Intestine - Terminal Ileum 17,954

Liver 18,071

Thyroid 18,024

Adrenal Gland 18,071

Vagina 17,834

Nerve - Tibial 18,007

Pancreas 18,123

Esophagus - Gastroesophageal Junction 18,000

Colon - Sigmoid 18,089

Pituitary 18,147

Adipose - Visceral (Omentum) 17,937

Esophagus - Muscularis 18,017

Stomach 17,879

Kidney - Cortex 17,329

Adipose - Subcutaneous 18,110

Esophagus - Mucosa 18,076

Ovary 17,971

Breast - Mammary Tissue 18,103

Brain - Hypothalamus 18,169

Heart - Atrial Appendage 17,896

Colon - Transverse 17,825

Brain - Frontal Cortex (BA9) 18,069

Brain - Cortex 18,039

Minor Salivary Gland 18,005

Brain - Spinal cord (cervical c-1) 17,973

Skin - Sun Exposed (Lower leg) 17,968

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Hippocampus 18,011

Skin - Not Sun Exposed (Suprapubic) 18,081

Brain - Substantia nigra 17,981

Brain - Nucleus accumbens (basal ganglia... 18,024

Cells - Transformed fibroblasts 17,577

Brain - Caudate (basal ganglia) 18,001

Brain - Amygdala 18,006

Brain - Putamen (basal ganglia) 17,863

Cells - EBV-transformed lymphocytes 18,186

Heart - Left Ventricle 18,006

Fetal Brain 7,866

Brain

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Skeletal muscle 549

Testis 3,897

Synonym

Accession	Q8N8F7 Q49AR6
Symbols	C7orf53

Gene

LSMEM1

Ortholog (7)

Species	Source	Disease
Chimp 14,140	OMA EggNOG
Dog 15,073	OMA EggNOG
Mouse 16,570	Inparanoid OMA EggNOG
Cow 15,320	OMA EggNOG
Horse 14,252	OMA EggNOG
Chicken 7,827	OMA EggNOG
Opossum 12,230	OMA EggNOG

UniProt Keyword (8)

Complete proteome 20,231

Reference proteome 20,231

Alternative splicing 10,528

Phosphoprotein 8,216

Membrane 7,361

Transmembrane 5,228

Transmembrane helix 5,207

Coiled coil 2,153

GO Component (2)

cytosol 4,834

integral component of membrane 3,665

Compartment GO Term (12)

Cell 16,178

Cell part 16,177

Cytoplasm 10,983

Cytoplasmic part 9,247

Cytosol 6,686

Integral component of membrane 5,331

Intracellular 14,109

Intracellular part 13,972

Intrinsic component of membrane 5,458

Membrane 8,531

Membrane part 6,554

cellular_component 18,320

GWAS Trait (1)

Osteoarthritis (hip) 4

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

AA Sequence

MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIV      1 - 70
LIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN              71 - 131
//

Text Mined References (7)

Summary
Details

	PMID	Year	Title