Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.66
PubTator Score 4.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 5.0e-03
atypical teratoid / rhabdoid tumor -1.200 2.4e-03
glioblastoma -1.100 8.8e-03
group 3 medulloblastoma 1.400 2.5e-02
osteosarcoma -2.020 6.5e-08
psoriasis -2.300 1.5e-05
Rheumatoid arthritis 1.400 2.1e-02

Gene RIF (1)

AA Sequence

MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFR      1 - 70
GSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASL     71 - 140
GLGAGFPSIPVGKSPMVEQAVQTGSADNLNAKKLLPGKGTTGTQLNGRQAQPSSKTASDVVQPAAVQAQG    141 - 210
QVNDENRRPQRRRSGNRRTRNRSRGQNRPTNVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKDD    211 - 280
KAEKGEEKDLAVVTQSAEAPAEEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSG    281 - 350
RFLRGRSSRGGFRGGRGNGTTRRNPTSHRAGTGRV                                       351 - 385
//

Text Mined References (14)

PMID Year Title