Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.90
PubTator Score 5.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.646 5.5e-05
adrenocortical carcinoma -2.240 1.1e-02
aldosterone-producing adenoma -1.037 3.3e-02
breast carcinoma -1.100 5.2e-03
Common variable immunodeficiency -2.630 1.7e-04
ductal carcinoma in situ -1.400 1.4e-02
interstitial cystitis -1.300 8.8e-03
invasive ductal carcinoma -1.900 1.0e-02
lung adenocarcinoma -2.000 1.2e-17
lung cancer -2.300 3.0e-04
lung carcinoma -1.800 1.6e-08
non-small cell lung cancer -2.798 5.8e-19
osteosarcoma 2.074 2.4e-02
ovarian cancer -1.400 1.3e-04
pituitary cancer 2.100 7.0e-06
sarcoidosis -1.200 1.5e-05

Gene RIF (4)

AA Sequence

MKDMPLRIHVLLGLAITTLVQAVDKKVDCPRLCTCEIRPWFTPRSIYMEASTVDCNDLGLLTFPARLPAN      1 - 70
TQILLLQTNNIAKIEYSTDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELS     71 - 140
NLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEILMIGENPIIRIKDMNFKP    141 - 210
LINLRSLVIAGINLTEIPDNALVGLENLESISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDF    211 - 280
SNMLHLKELGINNMPELISIDSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALY    281 - 350
HGTIESLPNLKEISIHSNPIRCDCVIRWMNMNKTNIRFMEPDSLFCVDPPEFQGQNVRQVHFRDMMEICL    351 - 420
PLIAPESFPSNLNVEAGSYVSFHCRATAEPQPEIYWITPSGQKLLPNTLTDKFYVHSEGTLDINGVTPKE    421 - 490
GGLYTCIATNLVGADLKSVMIKVDGSFPQDNNGSLNIKIRDIQANSVLVSWKASSKILKSSVKWTAFVKT    491 - 560
ENSHAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPTIYQKNRKKCVNVTTKGLHPDQKEYEKNNTTTLM    561 - 630
ACLGGLLGIIGVICLISCLSPEMNCDGGHSYVRNYLQKPTFALGELYPPLINLWEAGKEKSTSLKVKATV    631 - 700
IGLPTNMS                                                                  701 - 708
//

Text Mined References (11)

PMID Year Title