| Tchem | Leucine-rich repeat-containing protein 59 |
Required for nuclear import of FGF1, but not that of FGF2. Might regulate nuclear import of exogenous FGF1 by facilitating interaction with the nuclear import machinery and by transporting cytosolic FGF1 to, and possibly through, the nuclear pores.
Comments
| Disease | Target Count |
|---|---|
| IGA Glomerulonephritis | 454 |
| Disease | Target Count | P-value |
|---|---|---|
| lung adenocarcinoma | 2714 | 3.8e-12 |
| ovarian cancer | 8491 | 1.4e-06 |
| medulloblastoma, large-cell | 6234 | 1.4e-04 |
| breast carcinoma | 1614 | 1.5e-04 |
| invasive ductal carcinoma | 2950 | 7.2e-04 |
| pancreatic cancer | 2300 | 8.1e-04 |
| primary pancreatic ductal adenocarcinoma | 1271 | 1.5e-03 |
| psoriasis | 6685 | 1.6e-03 |
| Multiple myeloma | 1327 | 5.2e-03 |
| glioblastoma | 5572 | 5.9e-03 |
| non diabetic and post-ischemic heart failure | 200 | 7.9e-03 |
| lung cancer | 4473 | 1.2e-02 |
| inflammatory breast cancer | 404 | 1.3e-02 |
| Disease | log2 FC | p |
|---|---|---|
| Multiple myeloma | 1.210 | 5.2e-03 |
| psoriasis | 1.100 | 1.6e-03 |
| glioblastoma | 1.300 | 5.9e-03 |
| non diabetic and post-ischemic heart fai... | -1.200 | 7.9e-03 |
| medulloblastoma, large-cell | 1.200 | 1.4e-04 |
| primary pancreatic ductal adenocarcinoma | -1.537 | 1.5e-03 |
| lung cancer | 1.200 | 1.2e-02 |
| breast carcinoma | 1.600 | 1.5e-04 |
| lung adenocarcinoma | 1.300 | 3.8e-12 |
| inflammatory breast cancer | 1.100 | 1.3e-02 |
| invasive ductal carcinoma | 1.900 | 7.2e-04 |
| ovarian cancer | 3.200 | 1.4e-06 |
| pancreatic cancer | -1.800 | 8.1e-04 |
| PMID | Text | |
|---|---|---|
| 26466955 | Endosomal localization of endogenous TLR3 was decreased by silencing of LRRC59, suggesting that LRRC59 promotes UNC93B1-mediated translocation of NA-sensing TLRs from the ER upon infection. | |
| 25833693 | we provide a novel therapeutic mechanism for inhibiting CIP2A function in cancerous cells via targeting the CIP2A-LRRC59 interaction. | |
| 23125841 | Tandem affinity purification and mass spectrometry analysis identify leucine rich repeat containing 59 (LRRC59), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells | |
| 22321063 | LRRC59 facilitates transport of cytosolic FGF1 through nuclear pores by interaction with Kpns and movement of LRRC59 along the ER and NE membranes |
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCGLTHLVKLDLS 1 - 70 KNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPLDPVLAKVAGDCLDEKQCKQC 71 - 140 ANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAKEAQERELRKREKAEEKERRRKEYDALKAAK 141 - 210 REQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKLLLLLLLFGVAGGLVACRVTELQQQPLCTSV 211 - 280 NTIYDNAVQGLRRHEILQWVLQTDSQQ 281 - 307 //
| PMID | Year | Title | |
|---|---|---|---|
| 26466955 | 2015 | LRRC59 Regulates Trafficking of Nucleic Acid-Sensing TLRs from the Endoplasmic Reticulum via Association with UNC93B1. | |
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. | |
| 25833693 | 2015 | Leucine-rich repeat-containing protein 59 mediates nuclear import of cancerous inhibitor of PP2A in prostate cancer cells. | |
| 25468996 | 2014 | E-cadherin interactome complexity and robustness resolved by quantitative proteomics. | |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. | |
| 22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. | |
| 22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. | |
| 22321063 | 2012 | Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpn?1 and Kpn?1. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 19946888 | 2010 | Defining the membrane proteome of NK cells. | |
| 18669648 | 2008 | A quantitative atlas of mitotic phosphorylation. | |
| 18063578 | 2008 | The layered structure of human mitochondrial DNA nucleoids. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17353931 | 2007 | Large-scale mapping of human protein-protein interactions by mass spectrometry. | |
| 16751776 | 2006 | A germline-specific class of small RNAs binds mammalian Piwi proteins. | |
| 16541025 | 2006 | Shugoshin collaborates with protein phosphatase 2A to protect cohesin. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12665801 | 2003 | Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11964394 | 2002 | Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor. | |
| 8889548 | 1996 | Normalization and subtraction: two approaches to facilitate gene discovery. |
