Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.61
PubTator Score 18.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.210 5.2e-03
psoriasis 1.100 1.6e-03
glioblastoma 1.300 5.9e-03
non diabetic and post-ischemic heart fai... -1.200 7.9e-03
medulloblastoma, large-cell 1.200 1.4e-04
primary pancreatic ductal adenocarcinoma -1.537 1.5e-03
lung cancer 1.200 1.2e-02
breast carcinoma 1.600 1.5e-04
lung adenocarcinoma 1.300 3.8e-12
inflammatory breast cancer 1.100 1.3e-02
invasive ductal carcinoma 1.900 7.2e-04
ovarian cancer 3.200 1.4e-06
pancreatic cancer -1.800 8.1e-04

Gene RIF (4)

PMID Text
26466955 Endosomal localization of endogenous TLR3 was decreased by silencing of LRRC59, suggesting that LRRC59 promotes UNC93B1-mediated translocation of NA-sensing TLRs from the ER upon infection.
25833693 we provide a novel therapeutic mechanism for inhibiting CIP2A function in cancerous cells via targeting the CIP2A-LRRC59 interaction.
23125841 Tandem affinity purification and mass spectrometry analysis identify leucine rich repeat containing 59 (LRRC59), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22321063 LRRC59 facilitates transport of cytosolic FGF1 through nuclear pores by interaction with Kpns and movement of LRRC59 along the ER and NE membranes

AA Sequence

MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCGLTHLVKLDLS      1 - 70
KNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPLDPVLAKVAGDCLDEKQCKQC     71 - 140
ANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAKEAQERELRKREKAEEKERRRKEYDALKAAK    141 - 210
REQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKLLLLLLLFGVAGGLVACRVTELQQQPLCTSV    211 - 280
NTIYDNAVQGLRRHEILQWVLQTDSQQ                                               281 - 307
//

Text Mined References (23)

PMID Year Title
26466955 2015 LRRC59 Regulates Trafficking of Nucleic Acid-Sensing TLRs from the Endoplasmic Reticulum via Association with UNC93B1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25833693 2015 Leucine-rich repeat-containing protein 59 mediates nuclear import of cancerous inhibitor of PP2A in prostate cancer cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22321063 2012 Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpn?1 and Kpn?1.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16541025 2006 Shugoshin collaborates with protein phosphatase 2A to protect cohesin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11964394 2002 Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.