Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma -1.600 6.0e-04
pilocytic astrocytoma -1.200 4.4e-05
posterior fossa group B ependymoma 1.500 2.5e-05
nasopharyngeal carcinoma -1.900 5.2e-08
pituitary cancer -1.700 1.1e-03
psoriasis -1.600 5.7e-29

AA Sequence

MGIAESTPDELPSDAEEQLRSGDQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELR      1 - 70
ILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQLQSLRCLWIEGNFLRRFPRPLLRLVALQS     71 - 140
LQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFS    141 - 210
YDHNPVTGPPRVADTVFLVGEGAVERMAERDEPTPRPPPRRPARAFEDEEEEDLLIGGAGSRALGAPGGS    211 - 280
FRALEAAPGLGT                                                              281 - 292
//

Text Mined References (1)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.