Property Summary

NCBI Gene PubMed Count 125
PubMed Score 515.38
PubTator Score 246.78

Knowledge Summary


No data available


  Disease (8)

Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 0.7
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 5.0
Disease Target Count
Congenital diaphragmatic hernia 67


  Differential Expression (11)

Disease log2 FC p
Breast cancer -2.300 7.1e-04
ovarian cancer -1.300 3.6e-07
atypical teratoid / rhabdoid tumor 1.400 1.7e-03
lung adenocarcinoma -1.300 2.4e-06
lung cancer -1.700 9.8e-03
nephrosclerosis -1.096 2.6e-02
non-small cell lung cancer -1.398 1.9e-13
Pick disease -1.200 2.7e-02
progressive supranuclear palsy -1.500 3.8e-02
psoriasis -1.700 1.9e-10
subependymal giant cell astrocytoma -1.068 3.7e-02

 CSPA Cell Line (2)

Protein-protein Interaction (1)

Gene RIF (67)

AA Sequence

AKPKPPSRRDPTPTYSATEDTFKDTANLVKEDSEV                                      4621 - 4655

Text Mined References (130)

PMID Year Title