Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.23
PubTator Score 1.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -2.200 3.9e-03
ependymoma -1.400 2.3e-02
oligodendroglioma -1.600 1.9e-15
glioblastoma -1.900 2.1e-07
medulloblastoma -1.700 2.3e-04
atypical teratoid / rhabdoid tumor -1.500 3.0e-05
medulloblastoma, large-cell -2.100 2.2e-05
primitive neuroectodermal tumor -1.300 5.4e-04
autosomal dominant Emery-Dreifuss muscul... 1.154 1.7e-03
juvenile dermatomyositis 1.182 3.3e-10
acute quadriplegic myopathy 2.079 6.8e-08
primary pancreatic ductal adenocarcinoma 1.016 6.9e-03
interstitial cystitis -1.300 3.2e-04
adult high grade glioma -1.600 2.0e-03
pilocytic astrocytoma -1.200 2.8e-04
nasopharyngeal carcinoma -2.100 1.3e-04
lung carcinoma 1.100 1.4e-20
spina bifida -1.461 2.4e-02
ovarian cancer -2.700 1.5e-06

Gene RIF (1)

PMID Text
18976975 Knockdown of low density lipoprotein receptor-related protein 11 (LRP11) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MASVAQESAGSQRRLPPRHGALRGLLLLCLWLPSGRAALPPAAPLSELHAQLSGVEQLLEEFRRQLQQER      1 - 70
PQEELELELRAGGGPQEDCPGPGSGGYSAMPDAIIRTKDSLAAGASFLRAPAAVRGWRQCVAACCSEPRC     71 - 140
SVAVVELPRRPAPPAAVLGCYLFNCTARGRNVCKFALHSGYSSYSLSRAPDGAALATARASPRQEKDAPP    141 - 210
LSKAGQDVVLHLPTDGVVLDGRESTDDHAIVQYEWALLQGDPSVDMKVPQSGTLKLSHLQEGTYTFQLTV    211 - 280
TDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDGSDEDFCQNLGLD    281 - 350
RKMVTHTAASPALPRTTGPSEDAGGDSLVEKSQKATAPNKPPALSNTEKRNHSAFWGPESQIIPVMPDSS    351 - 420
SSGKNRKEESYIFESKGDGGGGEHPAPETGAVLPLALGLAITALLLLMVACRLRLVKQKLKKARPITSEE    421 - 490
SDYLINGMYL                                                                491 - 500
//

Text Mined References (6)

PMID Year Title
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.