Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.86
PubTator Score 13.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
chronic lymphosyte leukemia 1.700 2.8e-09
osteosarcoma -2.940 2.2e-04
periodontitis 1.100 3.6e-20
medulloblastoma, large-cell -1.300 3.2e-03
primary pancreatic ductal adenocarcinoma -1.210 2.9e-02
intraductal papillary-mucinous adenoma (... -1.500 4.6e-03
intraductal papillary-mucinous carcinoma... -2.200 1.3e-02
intraductal papillary-mucinous neoplasm ... -2.300 2.1e-03
colon cancer -1.100 1.0e-02
lung cancer -1.700 5.5e-04
active Crohn's disease -1.246 1.5e-02
group 3 medulloblastoma -1.100 1.4e-02
primary Sjogren syndrome 2.700 2.7e-04
nasopharyngeal carcinoma -1.400 4.4e-02
lung carcinoma -1.500 1.2e-16
pancreatic cancer -1.200 3.7e-02

Gene RIF (7)

PMID Text
20639392 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18299280 Observational study of gene-disease association. (HuGE Navigator)
16410263 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MESTPFSGVANQIHTLCERPTYGEVKDGALDVKRQHKCPGPTSGPSPGTNLSGCIRMNDDPSMEENGVER      1 - 70
VCPESLLQSREYSSLPLPRHTSSTDGTITSSDPGLEILNMASCDLDRNSLCKKEEDTRSASPTIEAQGTS     71 - 140
PAHDNIAFQDSTSKDKTILNLEAKEEPETIEEHKKEHASGDSVVSPLPVTTVKSVNLRQSENTSANEKEV    141 - 210
EAEFLRLSLGFKCDWFTLEKRVKLEERSRDLAEENLKKEITNCLKLLESLTPLCEDDNQAQEIIKKLEKS    211 - 280
IKFLSQCAARVASRAEMLGAINQESRVSKAVEVMIQHVENLKRMYAKEHAELEELKQVLLQNERSFNPLE    281 - 350
DDDDCQIKKRSASLNSKPSSLRRVTIASLPRNIGNAGMVAGMENNDRFSRRSSSWRILGSKQSEHRPSLP    351 - 420
RFISTYSWADAEEEKCELKTKDDSEPSGEETVERTRKPSLSEKKNNPSKWDVSSVYDTIASWATNLKSSI    421 - 490
RKANKALWLSIAFIVLFAALMSFLTGQLFQKSVDAAPTQQEDSWTSLEHILWPFTRLRHNGPPPV         491 - 555
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
18299280 2008 Association of KRAS polymorphisms with risk for lung adenocarcinoma accompanied by atypical adenomatous hyperplasias.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16739114 2006 Jaw1/LRMP, a germinal centre-associated marker for the immunohistological study of B-cell lymphomas.
16541075 2006 The finished DNA sequence of human chromosome 12.
16410263 2006 A V141L polymorphism of the human LRMP gene is associated with survival of lung cancer patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9314557 1997 Two novel routes of transporter associated with antigen processing (TAP)-independent major histocompatibility complex class I antigen processing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8798562 1996 Carboxyl-terminal targeting and novel post-translational processing of JAW1, a lymphoid protein of the endoplasmic reticulum.
8021504 1994 Jaw1, A lymphoid-restricted membrane protein localized to the endoplasmic reticulum.