Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.97
PubTator Score 3.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.300 3.2e-03
ependymoma -3.000 2.7e-09
oligodendroglioma -2.100 8.9e-03
glioblastoma -3.900 1.9e-05
group 4 medulloblastoma -2.800 3.5e-04
atypical teratoid / rhabdoid tumor -4.000 3.8e-07
medulloblastoma, large-cell -3.500 2.5e-04
primitive neuroectodermal tumor -2.800 9.3e-03
Atopic dermatitis -1.600 4.5e-06
adrenocortical carcinoma -1.030 2.1e-05
intraductal papillary-mucinous carcinoma... -1.300 1.4e-04
intraductal papillary-mucinous neoplasm ... -1.400 2.0e-03
adult high grade glioma -3.600 1.2e-06
pilocytic astrocytoma -1.500 9.2e-04
invasive ductal carcinoma -1.653 3.7e-03
ovarian cancer -1.900 1.2e-10
pituitary cancer 3.600 7.5e-10
psoriasis -1.400 1.3e-32

Gene RIF (3)

PMID Text
21736948 SALM5/Lrfn5, has recently been implicated in severe progressive autism and familial schizophrenia, pointing to the clinical importance of SALMs.[review]
20410109 Expression of SALM family proteins SALM3 and SALM5 in nonneural and neural cells induces both excitatory and inhibitory presynaptic differentiation in contacting axons.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEKILFYLFLIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLADNFVTNIKRKD      1 - 70
FANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISS     71 - 140
TAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKL    141 - 210
PPDPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEE    211 - 280
EFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVK    281 - 350
DTGAFTCIASNPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQDK    351 - 420
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAAGTMYDLCVLAIY    421 - 490
DDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVASVLVFIIILMIRYKVCNNNGQ    491 - 560
HKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEENAQCCKATSDNVIQSSETCSSQDSSTTTSALP    561 - 630
PSWTSSTSVSQKQKRKTGTKPSTEPQNEAVTNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPN    631 - 700
ALLTNVDQIVQETQRLELI                                                       701 - 719
//

Text Mined References (15)

PMID Year Title
23459443 2014 Drug-gene interactions and the search for missing heritability: a cross-sectional pharmacogenomics study of the QT interval.
22443383 2012 Genome wide association study for plasma levels of natural anticoagulant inhibitors and protein C anticoagulant pathway: the MARTHA project.
21736948 2011 The SALM/Lrfn family of leucine-rich repeat-containing cell adhesion molecules.
20410109 2010 Selected SALM (synaptic adhesion-like molecule) family proteins regulate synapse formation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18585462 2008 Synaptic adhesion-like molecules (SALMs) promote neurite outgrowth.
18227064 2008 The SALM family of adhesion-like molecules forms heteromeric and homomeric complexes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16828986 2006 Comparative analysis of structure, expression and PSD95-binding capacity of Lrfn, a novel family of neuronal transmembrane proteins.
16630835 2006 SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.