Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.51
PubTator Score 11.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
22325041 Letter: Did not observe an association between LRCH-1 SNPs and knee osteoarthritis.
20237151 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
18049793 results suggest that there is no association between LRCH1 and knee osteoarthritis susceptibility
16891653 Observational study of gene-disease association. (HuGE Navigator)
16447229 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16447229 A genetic variant in LRCH1 was consistently associated with knee osteoarthritis in 3 samples from 2 populations.

AA Sequence

MATPGSEPQPFVPALSVATLHPLHHPHHHHHHHQHHGGTGAPGGAGGGGGGSGGFNLPLNRGLERALEEA      1 - 70
ANSGGLNLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPEAIV     71 - 140
NLQMLTYLNLSRNQLSALPACLCGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQL    141 - 210
KSLRELNVRRNYLKVLPQELVDLSLVKFDFSCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGK    211 - 280
VHIFKYLSIQACQIKTADSLYLHTMERPHLHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVP    281 - 350
MSNIMEEEQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKARAED    351 - 420
CEELLRIEEDVHWQTEGIISSSKDQDMDIAMIEQLREAVDLLQDPNGLSTDITERSVLNLYPMGSAEALE    421 - 490
LQDSALNGQIQLETSPVCEVQSDLTLQSNGSQYSPNEIRENSPAVSPTTNSTAPFGLKPRSVFLRPQRNL    491 - 560
ESIDPQFTIRRKMEQMREEKELVEQLRESIEMRLKVSLHEDLGAALMDGVVLCHLVNHIRPRSVASIHVP    561 - 630
SPAVPKLSMAKCRRNVENFLEACRKLGVPEADLCSPCDILQLDFRHIRKTVDTLLALGEKAPPPTSALRS    631 - 700
RDLIGFCLVHILFIVLVYITYHWNALSA                                              701 - 728
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22325041 Genetic association analysis of LRCH-1 for knee osteoarthritis.
20805893 2010 LRCH proteins: a novel family of cytoskeletal regulators.
20237151 2010 Field synopsis and synthesis of genetic association studies in osteoarthritis: the CUMAGAS-OSTEO information system.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18049793 2008 Lack of association of single nucleotide polymorphism in LRCH1 with knee osteoarthritis susceptibility.
17762607 2007 New gene associations in osteoarthritis: what do they provide, and where are we going?
16891653 2007 Genetic association analysis of LRCH1 as an osteoarthritis susceptibility locus.
16447229 2006 Association between a variation in LRCH1 and knee osteoarthritis: a genome-wide single-nucleotide polymorphism association study using DNA pooling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.