Property Summary

NCBI Gene PubMed Count 641
PubMed Score 847.49
PubTator Score 2480.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Familial lipoprotein lipase deficiency 3 0.0 5.0
Disease Target Count Z-score Confidence
Familial hyperlipidemia 6 0.0 4.0
Disease Target Count
Lipoprotein lipase deficiency 1

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma 1.500 2.9e-04
oligodendroglioma 3.400 1.3e-18
psoriasis -2.700 3.1e-06
cutaneous lupus erythematosus 1.500 1.5e-02
astrocytoma 3.400 2.0e-22
glioblastoma 4.800 5.1e-04
osteosarcoma -1.613 4.7e-02
chronic lymphosyte leukemia 1.300 2.4e-03
primitive neuroectodermal tumor 1.800 1.8e-02
Atopic dermatitis -2.700 3.6e-03
chronic kidney disease -1.500 4.5e-02
tuberculosis and treatment for 6 months -1.300 3.1e-03
non-small cell lung cancer -3.692 2.1e-26
intraductal papillary-mucinous neoplasm ... -1.300 4.9e-02
lung cancer -5.900 6.1e-07
active Crohn's disease 2.905 1.1e-03
active ulcerative colitis 2.902 7.3e-03
breast carcinoma -2.800 9.4e-19
fibroadenoma -2.700 1.4e-02
lung adenocarcinoma -3.500 8.2e-15
pediatric high grade glioma 2.400 1.7e-04
pilocytic astrocytoma 2.700 1.9e-06
invasive ductal carcinoma -5.600 1.1e-04
nasopharyngeal carcinoma 1.400 3.1e-02
lung carcinoma 1.200 1.3e-11
Breast cancer -1.400 4.5e-04
mucosa-associated lymphoid tissue lympho... 1.434 4.4e-02
ductal carcinoma in situ -4.300 4.4e-04
dermatomyositis 1.600 3.4e-02

Protein-protein Interaction (10)

Gene RIF (618)

PMID Text
27159952 It can be suggested that the pronounced hypolipidemic effect of rosuvastatin in homozygotes +495GG of the LPL gene is associated with modulation of the LPL activity, as it has been previously reported for other statin drugs.
26975783 Asn291Ser(rs268), HindIII(rs320) and Ser447Ter(rs328) polymorphisms of lipoprotein lipase were associated with a risk of Alzheimer disease.[meta-analysis]
26503844 Individuals carrying the lipoprotein lipase (LPL) rs12678919 polymorphism (A --> G) had no significant change in the risk of developing AMD.
26420199 Lipoprotein lipase gene affects insulin resistance across different types of tissues.
26388538 capacity for triglyceride clearance seemed to be acutely reduced by alcohol consumption and the effect persisted for several hours. The levels of LPL activity in PHP were reduced to a similar extent
26370976 our results show the involvement of the variants of ESR1, LPL and CETP genes in metabolic events related to MetS or some of its features.
26342331 in well characterized FCHL individuals, variants in LDLR and LPL provide a small contribution to dyslipidemia
26214456 the LPL gene polymorphism was determined to be the main factor related to insulin resistance in women with gestational diabetes.
26188224 LPL polymorphisms may influence HDL-C concentration in lean men and may have a synergetic effect with Apo E to alter plasma triglyceride concentration in overweight men.
26101956 polymorphisms in LPL protect HIV-infected patients from developing atherogenic dyslipidemia in a dose-dependent manner
26026161 Conformational rearrangement of apoC-II at lipoprotein surfaces promotes interaction with LPL.
26025183 lipoprotein lipase polymorphism was not associated with the incidence of coronary heart disease in Sudan.
25995285 role of lipoprotein lipase in atherosclerosis
25966443 Report spectrum of mutations of LPL gene in Italian patients with severe hypertriglyceridemia.
25948680 Maternal overnutrition induces LPL expression in trophoblasts by reducing the inhibitory effect of SIRT1 on PPARgamma.
25897955 LPL loss-of-function mutations are associated with atherogenic dyslipidemia.
25811490 patients with the LPL Single nucleotide polymorphism rs13702 wild-type T/T genotype had significantly shorter overall survival than patients with C/C and T/C genotypes.
25809647 Chinese obese adolescents of Han nationality with GG genotype of the LPL rs283 polymorphism were more sensitive to exercise-induced parameter changes.
25784555 increasing adipose tissue LPL improves glucose metabolism in diet-induced obesity by improving the adipose tissue phenotype
25626708 Both common and uncommon/rare LPL variants/haplotypes may affect plasma lipoprotein-lipid levels in general African population.
25597500 Data suggest that up-regulation of plasma levels of LPL (lipoprotein lipase) and Angptl4 (angiopoietin-like 4 protein) can be used as biomarkers specific to detecting the stage of diabetic cardiovascular complications.
25595992 Results indicated that LPL deficiency gave rise to increased alpha-syn aggregation and decreased UCHL1 expression, which may further influence synaptic function
25589507 the amount of LPL expressed in muscle and heart governed both the binding of chylomicron particles and the assimilation of chylomicron lipids in the tissue.
25579610 We demonstrate a significant association of LPL and CETP polymorphisms with serum triglycerides and HDL-cholesterol.
25445417 Serum lipoprotein lipase level in patients with diabetes mellitus and metabolic syndrome affects the particle size of remnant lipoproteins.
25387803 GPIHBP1 missense mutations leading to protein multimerization prevent lipoprotein lipase binding.
25239670 The role of serum lipoprotein lipase in remnant lipoprotein metabolism.
25156894 In women, lpl SNPs interacted with dietary polyunsaturated fatty acidsfor body mass index and waist circumference
25149060 Data indicate that microRNA-590 (miR-590) can directly target the 3'UTR of lipoprotein lipase (LPL).
25131724 In a cohort with diabetic lipemia, one patient had an LPL mutation and LPL levels were lower than in control.
25073452 APOE has little influence on physical capability. In addition, other LDL-C-related genotypes have little impact on these traits.
24990426 Data from cohorts in Spain suggest an SNP in microRNA-410 recognition element in 3prime-untranslated region of lipoprotein lipase (rs13702) is associated with response to Mediterranean diet in treatment of hypertriglyceridemia and stroke prevention.
24988117 These findings suggest a protective effect of lipoprotein lipase polymorphisms against hypertriglyceridemia in children after 1 year of HAART.
24974629 The genotypic distribution of the LPL gene S447X variant was 90.6% for the homozygous genotype SS447 and 9.4% for the heterozygote SX447. No association between the S447X polymorphism of lipoprotein lipase gene and plasma lipids was observed.
24905278 LPL may represent a link between low adiponectin and dyslipidemia found in metabolic syndrome and type 2 diabetes mellitus
24886709 LPL variants were associated with dyslipidemia and obesity in Mexicans.
24847699 DNA methylation levels within placental LPL are associated with gestational diabetes mellitus.
24793350 patients with type I hyperlipoproteinemia harbored homozygous or compound heterozygous mutations in case series
24762672 The G allele of LPL rs326 is associated with increased levels of HDL-C and Apo A-I after a high carbohydrate low fat diet in the healthy young Chinese Han subjects.
24704626 In individuals with mixed dyslipidemia rare synonymous variants within LPL gene were associated with attenuated response to fenofibric acid therapy.
24704550 Wild-type lipoprotein lipase (LPL) and a mutated (S447X-LPL) protein bind to the endothelial cell LPL transporter GPIHBP1 with equal efficiency.
24646025 study showed that compound heterozygote mutations of A98T and L279V inactivate lipoprotein lipase enzymatic activity and contribute to severe HTG and acute pancreatitis in two Chinese patients.
24591733 the clinical features and genetic analysis of three patients with severe hypertriglyceridaemia including novel mutations LPL c.464T>C (p.Leu155Pro) and APOA5 c.823C>T (p.Gln275*).
24462462 The HindIII G allele in lipoprotein lipase gene may be a protective factor against the development of hypertensive intracranial hemorrhage among the Han Chinese population.
24458708 LPL was decreased in metabolic syndrome, overweight and obesity. compared with normal weight group; inversely correlated %TG-very low-density lipoproteins and TG/apolipoprotein B index in controls.
24407533 Lipoprotein lipase polymorphism is an independent risk factor for the first myocardial infarction in Indian population.
24400599 genetic association study in Romanian population: Data suggest that newborn/maternal polymorphisms in LpL [Ser447Stop (rs328); Asn291Ser (rs268)] influence severity of pre-eclampsia, modulate lipid profile, and contribute to pregnancy outcome.
24340925 Polymorphisms Ser447Ter of lipoprotein-lipase gene, Cys112Arg and Arg158Cys of apolipoprotein E gene in patients with obesity
24314358 Two groups of SNPs in the 3' UTR of lipoprotein lipase, based on allelic association, were statistically significantly associated with plasma triglycerides.
24308220 According to obtained results LPL and PPARG gene variants could be susceptibility factors of obesity and lipid status, contributing to development of metabolic syndrome, particularly in males.
24223199 The findings suggest that LIPC and LPL genes could both modify the risk for AMD and the metabolism of lutein and zeaxanthin.
24212298 Common variants and haplotypes in LPL with significant associations with lipid traits.
24205968 Ser447Ter and Asn291Ser variants associated with severe preeclampsia and influence the lipid profile and pregnancy outcome in mild and severe preeclampsia
24121499 apoC-I and apoC-III inhibit lipolysis by displacing LPL from lipid emulsion particles. We also propose a role for these apolipoproteins in the irreversible inactivation of LPL by factors such as angptl4.
24081181 LPL activity is decreased in female, but not in male, subjects heterozygous for a number of different LPL gene mutations
24009459 Case Report: extreme gestational hyperlipidemia with a partial LPL deficiency in the absence of an LPL gene mutation and the apolipoprotein E 3/2 genotype.
24004859 The Lipoprotein lipase(LPL) was reduced in Alzheimer's disease(AD) CSF samples relative to those in controls.
23991054 Results indicate the spatial consensus catalytic triad "Ser-Asp-His", a characteristic motif in lipoprotein lipase, hepatic lipase, and endothelial lipase.
23902956 We found that carrying the T allele reflecting the LPL x447 allele was positively associated with follow-up measurement of HDL-C concentrations (P < 0.001).
23880163 In non-small cell lung cancer tissue, a subpopulation of tumor-associated macrophages highly expresses LPL.
23761384 A mutation in the lipoprotein lipase gene (N291S) and a novel duplication (R44Kfs*4) are found in a case of familial lipoprotein lipase deficiency.
23735640 Our study demonstrated that rs1059611 was associated with HDL-C and TG concentrations in Chinese Han population and might have a functional effect on the transcription of LPL by differential binding of transcription factors.
23661675 Although partial Angptl3 deficiency did not affect the activities of lipolytic enzymes, the complete absence of Angptl3 results in an increased lipoprotein lipase activity and mass and low circulating free fatty acid levels.
23623643 CETP and LPL DNA methylation levels are associated with blood lipid profile in familial hypercholesterolemia.
23614796 Methylation status regulates lipoprotein lipase expression in chronic lymphocytic leukemia.
23478142 While possibly reflecting an epigenetic switch towards an incorrect transcriptional program, LPL overexpression by itself does not appear to significantly influence chronic lymphocytic leukemia cell survival.
23377670 Lipoprotein lipase/APOC3 genotype determines severity of coronary artery disease.
23344322 results indicated that rs2197089 was significantly associated with triglycerides but it was associated with HDL-C only in smokers; this SNP seemed to have influence on the expression level of LPL
23320821 Lipoprotein lipase was found to be associated with vitamin D, insulin resistance and type 2 diabetes in a Chinese population.
23089926 LPL gene polymorphisms can confer susceptibility for hypertension and type 2 diabetes in Mexican families.
23056264 Findings suggest that fatty acids (FAs)-PPARdelta/RXR-Angptl4 axis controls the lipoprotein lipase (LPL)-dependent uptake of FAs in myotubes.
23008484 The GPIHBP1 and LPL move bidirectionally across endothelial cells in vesicles and that transport is efficient even when caveolin-1 is absent.
22837712 DNA polymorphisms of the lipoprotein lipase gene and their association with coronary artery disease in the Saudi population
22828442 Absence of Lipoprotein lipase expression and methylated status is associated with chronic lymphocytic leukemia.
22820186 inactivation of LPL in THP-1 macrophages primarily occurs on the cell surface where oligomers of ANGPTL4 are formed.
22810051 HindIII (-/-) genotype of LPL is associated with response to therapy in ischemic stroke.
22773878 Fatty acids bind tightly to the N-terminal domain of angiopoietin-like protein 4 and modulate its interaction with lipoprotein lipase.
22772754 ABCG1 controls LPL activity and promotes lipid accumulation in human macrophages in the presence of triglyceride-rich lipoproteins.
22729917 Six lipoprotein lipase gene polymorphisms, lipid profile and coronary stenosis in a Tunisian population
22541364 The LPL HindIII genotype is significantly associated with ischemic stroke subtypes and elevated levels of plasma triglycerides and reduced HDL cholesterol levels.
22368174 These data suggest that decreased mitochondrial content in muscle of insulin resistant offspring may be due in part to reductions in LPL expression in skeletal muscle resulting in decreased PPAR-delta activation.
22244040 Suggest that the LPLS447X gain of function may be due to the base change in the LPL mRNA resulting in a decreased susceptibility to translational inhibition.
22239554 The mutations in LPL are mostly restricted to patients with type 1 hypertriglyceridaemia
22123668 Proper regulation of LPL is important for controlling the delivery of lipid nutrients to tissues. [Review]
22101375 This study sought to test the effects of LPL polymorphisms and a high-carbohydrate low-fat diet on the serum lipid profile of Han Chinese.
22095987 results confirm that hypertriglyceridemia is a key feature of familial LPL deficiency. This is due to impaired VLDL- and IDL-apoB-100 catabolism and VLDL-to-IDL conversion. Single-allele mutations of the LPL gene result in modest to elevated plasma triglycerides. The changes in plasma triglycerides and apoB-100 kinetics are attributable to the effects of the LPL genotype
22078753 insulin-mediated regulation of LPL is not directly linked to the control of glucose turnover by insulin or to angiopoietin-related protein 4 expression in adipose tissue or plasma
22018640 The pro-inflammatory properties of VLDL were attenuated by eicosapentaenoic acid administration via decrease in susceptibility of VLDL to LPL.
21980507 Hematopoietic cell-derived LPL could efficiently ameliorate severe hypertriglyceridemia and hypo-alpha-cholesterolemia at the compensation of increased triglyceride content of liver
21978733 A polymorphism in the GPIHBP1 gene promoter was associated with an increased risk of hypertriglyceridemia and had an additive effect on the risk conferred by LPL defective alleles.
21966368 Data show that LPL, FABP4, LRP1 and ASP expression in visceral adipose tissue was higher in lean controls, while in subcutaneous adipose tissue, LPL and FABP4 expression were also higher in lean controls.
21943158 variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits
21862952 These results suggest that rs253 C allele and CC genotype of LPL confer risk for schizophrenia in men.
21854610 genetic association studies in populations in the United States: Lipoprotein lipase gene variants (D9N/rs1801177; S447X/rs328) are associated with two patterns of lipoprotein diameter in metabolic syndrome.
21840003 Genetic variations at the lipoprotein lipase gene influence plasma lipid concentrations and interact with plasma n-6 polyunsaturated fatty acids to modulate lipid metabolism
21816453 meta-analysis indicated that LPL Ser447Ter polymorphism was associated with a significant reduction in the risk of ischemic stroke, especially atherosclerotic stroke subtype in both Caucasian and East-Asian
21722517 In this rewiev, the roles of polymorphism lipoprotein lipase and their implications in the control of lipoprotein metabolism and atherosclerosis are discussed, especially in the group of risk developing metabolic syndrome
21621348 No significant association between genetic variants of the LPL gene and coronary heart disease in this Tunisian population. The very low frequency of the p.Asn291Ser variation may be an ethnic specificity of Tunisians.
21518912 report that two LPL missense mutations initially identified in patients with chylomicronemia, C418Y and E421K, abolish LPL's ability to bind to GPIHBP1 without interfering with LPL catalytic activity or binding to heparin
21508119 LPL expression is the strongest RNA-based prognostic marker in chronic lymphocytic leukemia.
21499891 polymorphisms in the lipoprotein lipase gene are associated with dyslipidemia and increased risk of myocardial infarction
21478160 the Ly6 domain of GPIHBP1 is important for the ability of GPIHBP1 to bind and transport LPL.
21448664 We found significantly higher levels of triglycerides, total cholesterol, and LDL and reduced HDL levels in patients with the lipoprotein lipase A1127G (AG) genotype, indicating the association of AG genotypes with dyslipidemia in an Indian population
21419757 Chinese adults with the LPL gene HindIII H-/H- genotype had a significantly increased risk of type 2 diabetes
21398697 the cleavage of ANGPTL4 by these PCs modulates its inhibitory effect on LPL activity.
21385844 LPL binds to SorLA in the biosynthetic pathway and is subsequently transported to endosomes.
21252727 A low plasma adiponectin level significantly contributed to the cardiometabolic risk profile of postmenopausal women with loss-of-function lipoprotein lipase mutations, independently of anthropometrics, lipids, and other covariates.
21252145 The effects of common variants in the LPL, LIPC, and CETP genes on HDL-C levels are modified by physical activity.
21193198 Polymorphisms in IL5RA, LPL, ITGA2 and NOS3 genes were independently associated with ischemic stroke in Chinese diabetic population.
21162862 The lipoprotein lipase gene Hind III and S447X polymorphisms were associated with metabolic syndrome risk in Kazakhs. The H+H-/H-H- genotype, H- allele, SX/XX genotype and X allele might be protective.
21159338 Rare variants in the lipoprotein lipase (LPL) gene are common in hypertriglyceridemia but rare in Type III hyperlipidemia.
21146168 LPL polymorphism (D9N) predicts cardiovascular disease risk directly and through interaction with CETP polymorphism (TaqIB) in women with high HDL cholesterol and CRP.
21127884 The S447X variant of lipoprotein lipase gene was associated with significant reduction in severity of coronary artery disease.
21060192 Letter: Serum lipoprotein lipase is up-regulated in chronic hemodialysis patients.
21044743 Increased fatty acid synthase activity in non-small cell lung cancer tissue is a weaker predictor of shorter patient survival than increased lipoprotein lipase activity.
20943490 LPL Pvupolymorphism was significantly associated with hyperlipoidemia but not with coronary heart disease in the Chinese population.
20943490 Meta-analysis of gene-disease association. (HuGE Navigator)
20929345 Sera from high viral load HIV-1-infected individuals induce a clear proadipogenic phenotype with increased expression of adipogenic markers including LPL and PPARgamma by HIV-1 Tat-mediated inhibition of COUP TF-1
20926921 Data show that hormone-sensitive lipase activity is reduced in adipose tissue of patients with and without diabetes, while lipoprotein lipase activity is reduces only in patients with diabetes.
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20836743 Variable effects of maternal and paternal-fetal contribution to the risk for preeclampsia combining GSTP1, eNOS, and LPL gene polymorphisms.
20836743 Observational study of gene-disease association. (HuGE Navigator)
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20694148 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20693566 The lipogenic effects of GIP in the presence of insulin are therefore at least partially mediated by upregulation of adipocyte LPL gene transcription through a pathway involving PI3-K/PKB/AMPK-dependent CREB/TORC2 activation.
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20657596 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20650961 Two single-nucleotide polymorphisms of LPL, rs327 and rs3289, were shown to affect triglyceride levels.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20616609 Lipid storage is decreased in the femoral depot after walking, regardless of menopausal status and eduction in LPL activity or expression does not lead to a more deleterious lipid-lipoprotein profile
20602615 Observational study of gene-disease association. (HuGE Navigator)
20596061 This meta-analysis demonstrated that LPL gene S447X variant was significantly associated with hypertension.
20596061 Meta-analysis of gene-disease association. (HuGE Navigator)
20595410 relationship between plasma angiopoietin-like protein 3 (ANGPTL3), and lipoprotein lipase (LPL) activity and hepatic triglyceride lipase
20588308 Observational study of gene-disease association. (HuGE Navigator)
20581395 a molecular connection between ANGPTL3, lipoprotein lipase, and proprotein convertases
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20538960 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20506644 Interactions of LPL Ser447Stop polymorphism on the lipid ratios of people on a high-carbohydrate/low-fat diet were gender-specific.
20506644 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20430392 Observational study of gene-disease association. (HuGE Navigator)
20430250 results imply a significant correlation of Ser447X polymorphism and its protective effect on Indians against severity of CAD modified by the risk of diabetes, than LPL HindIII and PPARgamma Pro12Ala
20430250 Observational study of gene-disease association. (HuGE Navigator)
20429872 Our results showed a significant independent additive effect on TG levels of the LPL polymorphisms HindIII, S447X, D9N and N291S; the S19W and -1131T/C variants of APOA5, and the epsilon4 allele of APOE in our study population.
20429872 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20421589 PPAR-alpha response is generated by unbound fatty acids released locally by lipase activity and not by circulating plasma fatty acids.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20410100 SNPs in LPL show strong statistical evidence of a funtional effect on plasma faatty acid distribution.
20410100 Observational study of gene-disease association. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20400780 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20385819 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20350420 D9N and N291S gene mutations of lipoprotein lipase may not be risk factors associated with cardiovascular diseases in children with obesity.
20350420 Observational study of gene-disease association. (HuGE Navigator)
20347446 common LPL gene sequence variants do not seem to have a role in hyperinsulinemia or risk of ischemic heart disease
20347446 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20235787 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20228263 Analysis identified a gene-set (LAG3, LPL, ZAP70) whose overexpression is assigned to unmutated immunoglobulin variable heavy chain region with 90% specificity.
20167577 Observational study of gene-disease association. (HuGE Navigator)
20160193 Observational study of gene-disease association. (HuGE Navigator)
20150529 Rs328 (Ser447Stop), rs326, and rs13702 were significantly associated with cross-sectional interindividual variations in triglycerides and HDL-C and with their longitudinal changes over time.
20150529 Observational study of gene-disease association. (HuGE Navigator)
20108206 Observational study of gene-disease association. (HuGE Navigator)
20099167 Observational study of gene-disease association. (HuGE Navigator)
20092038 results in elderly men show that carriers of LPL X allele have a better triglyceride/HDL-C ratio and that H-X haplotype carriers have lower triglyceride levels and a better triglyceride/HDL-C ratio.
20092038 Observational study of gene-disease association. (HuGE Navigator)
20075597 12 weeks of jogging training increases pre-heparin serum LPL concentrations in overweight/obese middle-aged men
20031591 Observational study of gene-disease association. (HuGE Navigator)
20031551 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910634 ApoA-II plays a crucial role in triglyceride catabolism by regulating lipoprotein lipase activity, at least in part, through HDL proteome modulation.
19899640 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19888660 Observational study of gene-disease association. (HuGE Navigator)
19884647 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19875996 differences in VLDL-TG storage in abdominal and femoral fat that occur with progressive obesity are regulated through mechanisms other than LPL activity
19834535 Observational study of gene-disease association. (HuGE Navigator)
19818126 Observational study of gene-disease association. (HuGE Navigator)
19783858 Data show that shows the arrangement of an evolutionarily conserved domain within LMF1 (DUF1222) that is essential to lipase maturation.
19780863 LPL and LIPG are reported in human testis and in germ cell neoplasms.
19773416 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19772655 study revealed that allelic association at ApoB, LPL, Leptin loci and loss of telomere length may have strong genetic association with hypertensive individuals
19772655 Observational study of gene-disease association. (HuGE Navigator)
19766899 Our study further underlines the involvement of cancer tissue LPL activity in tumor progression.
19729601 Observational study of gene-disease association. (HuGE Navigator)
19709746 LPL expression exceeded mutation status/IGHV3-21 usage as an independent prognostic marker in chronic lymphocytic leukemia
19692168 Observational study of gene-disease association. (HuGE Navigator)
19689828 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19664517 Carrier of (SS) genotype were at higher risk of developing hypertension when compared with carrier of other genotypes
19664517 Observational study of gene-disease association. (HuGE Navigator)
19656773 Observational study of gene-disease association. (HuGE Navigator)
19642912 Observational study of gene-disease association. (HuGE Navigator)
19629056 Identified significant interactions for apolipoprotein A5 S19W and lipoprotein lipase m107 for obesity in Caribbean Hispanics.
19629056 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19602472 Associations between PM(2.5) and HRV were modified by gene polymorphisms of APOE, LPL and VEGF.
19602472 Observational study of gene-disease association. (HuGE Navigator)
19584682 Tacrolimus-induced elevation in plasma triglyceride concentrations after administration to renal transplant patients is partially due to a decrease in lipoprotein lipase activity and plasma concentrations.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19563912 These data suggest the presence of an insulin response element in the 3'UTR of the LPL gene.
19558660 This study assessed the gender-specific influence of the cholesteryl ester transfer protein (TaqIB, I405V) and lipoprotein lipase (S447X) polymorphisms on the response to an oral fat tolerance test in heterozygotes for familial hypercholesterolaemia.
19558660 Observational study of gene-disease association. (HuGE Navigator)
19556723 The LPL S447X polymorphism might therefore be significantly associated with higher adiponectin levels, independent of HDL-C
19556723 Observational study of gene-disease association. (HuGE Navigator)
19542565 GPIHBP1 functions as an LPL stabilizer
19534808 No significant differences were found between the acute hypertriglyceridaemic pancreatitis cases and controls with severe hypertriglyceridaemia in terms of LPL activity and mass, hepatic lipase activity, CII and CIII mass, or apo E polymorphisms.
19501493 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19489872 Single nucleotide polymorphisms in ESR1, CETP and LPL had significant effects on baseline plasma levels of TG-rich and HDL subpopulations.
19489872 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19471043 Results show that cotransfection of LPL with wild-type Lmf1 restores its ability to support normal lipase maturation.
19428034 The two novel mutations in the CETP and LIPC genes found in this study are likely to be the causes of low enzyme activities and elevated HDL-C levels.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19403283 LPL may influence plasma lipoproteins; genetic association studies in Greek children suggest difference in allele frequency of LPL S447X variant between normal weight children & their overweight/obese counterparts.
19403283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19368142 The X447 allele of the LPL gene may protect from atherogenic LDL subfraction, although this effect is small.
19368142 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19367320 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
19367093 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19357293 LPL transgene plays an important role in learning and memory function possibly by influencing presynaptic function in a transgenic mouse.
19340428 Results support the use of LPL and ADAM29 gene expression associated to IGHV mutational status for predicting the clinical outcome of patients treated by oral fludarabine + cyclophosphamide and could be considered for treatment strategies.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19335919 relationship of pattern B LDL and lipids with N291S polymorphism of lipoprotein lipase in familial combined hyperlipidemia patients.
19335919 Observational study of gene-disease association. (HuGE Navigator)
19299407 Observational study of gene-disease association. (HuGE Navigator)
19295657 Novel LPL mutations associated with lipoprotein lipase deficiency.
19259048 LPL-PvuII polymorphism was not identified as an independent risk factor for the appearance of CAD
19259048 Observational study of gene-disease association. (HuGE Navigator)
19254215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19246456 the 12-amino acid consensus motif within the CCD of Angptl4, especially the three polar residues within this motif, is responsible for its interaction with and inhibition of LPL by blocking the enzyme dimerization.
19207029 LPL gene variant may cause triglyceride lowering after fibrate treatment among patients with hypertriglyceridemia.
19207029 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19191728 LPL X447 genotype, female gender and smoking habit interact in increasing preheparin serum LPL mass in Turkish adults. Serum LPL mass is inversely associated with MS and CHD, independent of confounders, and probably reflects insulin sensitivity.
19191728 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19185650 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19167106 recruited. The HindIII/H- and 447X alleles are associated with decreased CAD risk in both Chinese (p = 0.025, 0.001, respectively) and Indians (p = 0.0014, 0.008, respectively.
19167106 Observational study of gene-disease association. (HuGE Navigator)
19155782 Observational study of gene-disease association. (HuGE Navigator)
19148283 Observational study of gene-disease association. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19099922 Observational study of gene-disease association. (HuGE Navigator)
19052449 LPL 1595 C/G SNP was associated with significantly lower triglyceride levels
19052449 Observational study of gene-disease association. (HuGE Navigator)
19034316 No associations were found for four HL gene polymorphisms two LPL gene polymorphisms and type III HLP.
19034316 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19034041 LPL S447X mutation is associated with a higher risk of pancreatic calcification and steatorrhea than those previously known factors in hyperlipidemic pancreatitis (HLP)patients.
19034041 Observational study of gene-disease association. (HuGE Navigator)
19028676 The finding that ANGPTL3 and ANGPTL4 inhibit LPL activity through distinct mechanisms indicates that the two proteins play unique roles in modulation of lipid metabolism in vivo.
19018513 Effects of established gene variation on lipid and glucose traits do not tend to alter with age during adulthood or over time.
19018513 Observational study of gene-disease association. (HuGE Navigator)
19004026 biallelic inactivation of LPL by chromosomal deletion and promoter hypermethylation may play a role in human prostate cancer
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18986377 Observational study of gene-disease association. (HuGE Navigator)
18985010 Results suggest that the control of lipid level by LPL in the bloodstream might be an important factor in T2DM pathogenesis in the Korean population.
18985010 Observational study of gene-disease association. (HuGE Navigator)
18927546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18922999 Meta-analysis of gene-disease association. (HuGE Navigator)
18823627 Findings suggest that lipoprotein lipase D9N polymorphism can be a useful risk marker for myocardial infarction in type 2 diabetes.
18823627 Observational study of gene-disease association. (HuGE Navigator)
18724972 Observational study of gene-disease association. (HuGE Navigator)
18693040 results suggest no association and interaction of lipoprotein lipase T+495G polymorphism with central obesity and serum lipids for all twin pairs
18693040 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18681781 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18649389 this study strongly suggests that two lipoprotein lipase intronic variants may be associated with development of the hypertension endophenotype with elevated plasma triglyceride(s.
18636124 Observational study of gene-disease association. (HuGE Navigator)
18635818 Report effects of six APOA5 variants, identified in patients with severe hypertriglyceridemia, on in vitro lipoprotein lipase activity and receptor binding.
18619685 LPL gene variant is involved in carotid atherosclerotic lesions.
18619685 Observational study of gene-disease association. (HuGE Navigator)
18616755 It was showed that LPL expression correlates with IgVH mutational status and other clinical or laboratory prognostic factors, and might be applied for the assessment of prognosis in patients with chronic lymphocytic leukemia.
18603820 lipoprotein lipase mass in preheparin serum is lowered by the angiotensin II receptor antagonist telmisartan
18596051 Observational study of gene-disease association. (HuGE Navigator)
18590804 Our study suggests that PvuII and Ser447Ter polymorphisms are associated with lipid profile and cerebral infarctions
18590804 Observational study of gene-disease association. (HuGE Navigator)
18535540 reduced adipose tissue lipoprotein lipase expression, being significantly correlated with the decrease in insulin and prolactin, suggests a role of hyperinsulinemia and hyperprolactinemia in inducing and sustaining obesity.
18534873 In one prostate cancer group, disease progression was associated with chromosome 8 aneusomy, X polysomy, LPL gene deletion, and Gleason > 7 and 4 + 3
18513389 Observational study of gene-disease association. (HuGE Navigator)
18494281 genotype of gene LPL and B2 allele of gene CETP in patients elder 90 years are found significantly more frequently than in younger patients, that makes possible to consider they as markers of favorable course of disease and patients' long life.
18494281 Observational study of gene-disease association. (HuGE Navigator)
18449420 Observational study of gene-disease association. (HuGE Navigator)
18354102 Observational study of gene-disease association. (HuGE Navigator)
18336668 Observational study of gene-disease association. (HuGE Navigator)
18325076 Observational study of gene-disease association. (HuGE Navigator)
18321693 In insulin-resistant conditions of obesity. diabetics compared to obese subjects have increased postprandial chylomicron response and reduced adipose tissue LPL activity.
18275964 CETP, but not hepatic lipase or lipoprotein lipase, has a role in regulating HDL-c and LDL-c levels in menopausal women
18275964 Observational study of gene-disease association. (HuGE Navigator)
18275685 describe a case of familial LPL deficiency caused by compound heterozygosity for known (G188E) and novel (W394X) LPL gene mutations
18242618 the polymorphic HindIII site in the LPL gene is functional because it affects the binding of a transcription factor and it also has an impact on LPL expression
18223635 During a controlled low fat (30%) diet post-absorptive vastus lateralis lipoprotein lipase activity is higher in sedentary pre-menopausal African American as compared to non-Hispanic white women.
18193043 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of lipoprotein lipase (LPL) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187430 Observational study of gene-disease association. (HuGE Navigator)
18175800 transgenic overexpression of LPL in skeletal muscle increases cold tolerance by enhancing the capacity for fat oxidation
18068174 p.N318S is a major predisposing factor to hypertriglyceridaemia in the Northern Irish population
18068174 Observational study of gene-disease association. (HuGE Navigator)
18020971 Observational study of gene-disease association. (HuGE Navigator)
17997385 Data show that the G56R substitution did not affect the ability of GPIHBP1 to reach the cell surface, nor did the amino acid substitution have any discernible effect on the binding of lipoprotein lipase, chylomicrons, or apo-AV.
17939375 The haplotypes of S447X and Hind III polymorphisms were significantly related to the favorable effect of serum lipids,but this effect was mostly determined by the polymorphism of S447X.
17939375 Observational study of gene-disease association. (HuGE Navigator)
17919884 Observational study of gene-disease association. (HuGE Navigator)
17903299 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17855807 Observational study of gene-disease association. (HuGE Navigator)
17848837 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17803213 informational spectrum method applied to identifiy evolutionary highly conserved information encoded by LPL primary structure; it was demonstrated that mutations altering LPL activity also alter this information
17761930 Lipoprotein lipase is a bridging molecule that facilitates low-density lipoprotein retention in the artery wall of transgenic mice at later stages of development of atherosclerotic aortae.
17727701 Observational study of gene-disease association. (HuGE Navigator)
17727701 three common variants in the LPL gene are not an important factor in the development of Type III hyperlipidemia in probands with APOE2/2 genotype
17726453 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17721767 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17717288 Both common and rare DNA variants of lipoprotein lipase (LPL) gene were found in 10% patients with severe hypertriglyceridemia
17706445 Deletion-insertion mutation mediated by Alu repetitive elements leading to lipoprotein lipase deficiency is associated with acute pancreatitis
17705673 variants of apolipoprotein A-V combined with increased triglyceridemia are associated with lower lipoprotein lipase activity in vivo and with disturbances of regulation of nonesterified fatty acids
17705673 Observational study of gene-disease association. (HuGE Navigator)
17700364 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17681919 Data suggest that the Hind RFLP in the LPL gene is associated with T2DM risk in Chinese Han population in Hubei Province, and the H+ allele may serve as a genetic risk factor of T2DM.
17681919 Observational study of gene-disease association. (HuGE Navigator)
17662793 Observational study of gene-disease association. (HuGE Navigator)
17653444 serum concentrations of lipids did not differ between the LPL HindIII and apo E genotypes during pregnancy and after delivery. LPL PvuII SNP is associated with variations in serum lipids during pregnancy and the puerperal period in non-diabetic women.
17653444 Observational study of gene-disease association. (HuGE Navigator)
17652898 Circulating LPL concentrations decreased with the severity of obstructive sleep apnea syndrome
17644777 atorvastatin reduces LPL and EL expression by reducing the activation of LXRalpha and NF-kappaB, respectively
17620184 The higher lipoprotein lipase activity in lung cancer tissue provides a possible mechanism for increasing the supply of lipid nutrients to the tumor, necessary for tumor growth.
17615573 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17587400 Dydrogesterone and norethisterone increase secretion of LPL from abdominaal adipocytes.
17568951 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17562973 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17560523 The association between the LPL variants and hypertriglyceridemia is quite complicated and versatile; genotyping of LPL in a larger-scale screening should be necessary and justifiable
17560523 Observational study of gene-disease association. (HuGE Navigator)
17555736 Observational study of gene-disease association. (HuGE Navigator)
17555736 In especially Turkish women, compared to non-carriers, carriers of the LPL X447 allele have higher levels of HDL-C, LDL-C and total cholesterol, and show a degree of protection against developing the metabolic syndrome.
17535427 Changes in DNA methylation at adipogenic promoters during cellular aging.
17533471 Observational study of gene-disease association. (HuGE Navigator)
17533471 S447X polymorphism of lipoprotein lipase is related to a decrease in plasma triglyceride in male patients with CAD, but not female patients. The presence of the S447X lipoprotein lipase polymorphism was not associated with the incidence of CAD.
17517063 LPL could modulate HCV infectivity in vivo.
17487735 lipoprotein lipase and dystrophin have roles in survival in B-cell chronic lymphocytic leukemia
17484619 Observational study of gene-disease association. (HuGE Navigator)
17484619 LPL HindIII and S447X polymorphisms were analyzed in 343 individuals of 66-97 years of age from a cohort of a Brazilian elderly longitudinal study and related to myocardial infarction, HDL levels, and triglyceride levels.
17476032 Novel mutations of the LPL gene contribute to the hypertriglyceridemia observed in members of type 2 diabetic pedigrees.
17473385 Meta-analysis of gene-disease association. (HuGE Navigator)
17473385 The PvuII polymorphism cannot be used as independent genetic risk factor for coronary artery disease in patients of Saudi Arabic descent.
17436307 Observational study of genetic testing. (HuGE Navigator)
17428620 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17374417 Metformin may increase LPL production, thereby increasing low density lipoprotein particle size which may be independent of the hypoglycemic effect of metforminin type 2 diabetes.
17356047 EL and LPL are dysregulated in growth restricted pregnancy
17347923 cDNA microarray and Northern blots analysis were used to study the expression of lipoprotein lipase in lung adenocarcinoma tissues.
17342071 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17342071 Combined with abdominal obesity, epistasis in the VLDL pathway (lipoprotein lipase, apolipoprotein CIII, hepatic lipase, PPARalpha, PPARgamma, and apo E genes) has a deleterious effect on fasting triglycerides and coronary artery disease risk profile
17328917 Observational study of gene-disease association. (HuGE Navigator)
17328917 no reliable ischaemic stroke associations were found with LPL T+495G (HindIII) polymorphism in individuals of Yakut ethnicity
17318300 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17311894 Relationship between fasting LPL activity/fat cell and fat cell size in females. In males, this relationship was seen only in the abdomen.
17299379 Observational study of gene-disease association. (HuGE Navigator)
17299379 Among Asian Indians, the -T93G SNP of the LPL gene is associated with obesity but not type 2 diabetes, whereas the -G53C SNP appears to be protective against both obesity and type 2 diabetes.
17299085 The activity of placental LPL is reduced by high levels of maternal TG and/or FFA.
17291198 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17244606 protein kinase B, LKB1, and AMP-activated protein kinase have roles in activation of lipoprotein lipase by glucose-dependent insulinotropic polypeptide in adipocytes
17163816 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17163816 There was no significant correlation between polymorphism of the lipoprotein lipase gene at the PvuII site and serum lipid levels in the two ethnic chinese groups, i.e., the Guangxi Hei Yi Zhuang and Han populations.
17157861 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17157861 plasma HDL-Cholesterol differs according to lipoprotein lipase (LPL) genotypes and with dietary intake of fats
17137217 Observational study of gene-disease association. (HuGE Navigator)
17130180 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17093291 suppression of either LPL or EL decreases proinflammatory cytokine expression and influences the lipid composition of THP-1 macrophages
17072956 Observational study of gene-disease association. (HuGE Navigator)
17072956 Ser447stop and Hind III LPL polymorphisms may influence age of onset of ulcerative colitis (UC), while Hind III and Pvu II polymorphisms influence serum triglyceride in UC patients.
17058522 Observational study of gene-disease association. (HuGE Navigator)
17032721 Observational study of gene-disease association. (HuGE Navigator)
17029199 The Ser447Terls polymorphism of LPL gene is significantly associated with plasma lipids and CI. G allele genotype may lead to decrease of plasma TG and increase of plasma HDL-C. G allele may be a protective genotype of cerebral infarction.
17029199 Observational study of gene-disease association. (HuGE Navigator)
17006673 Observational study of gene-disease association. (HuGE Navigator)
17001213 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16989840 lipoprotein lipase X447 homozygotes exhibit enhanced apoB48 clearance
16965549 Observational study of gene-disease association. (HuGE Navigator)
16965549 a common polymorphism in the lipoprotein lipase gene modulates the risk level for sporadic AD in the eastern Canadian population but more importantly, indirectly modulates the pathophysiology of the brain in autopsy-confirmed cases.
16928730 Observational study of gene-disease association. (HuGE Navigator)
16926441 analysis of human placental lipoprotein lipase gestational and hormonal regulation
16896939 In adipose tissue, rosiglitazone increases LPL mRNA abundance and LPL transport rate and possibly increases endothelial binding sites for LPL, but affects neither tissue LPL activity nor LPL rate of action.
16894468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16864937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16840197 lipoprotein lipase has a role in B-cell chronic lymphocytic leukemia
16837242 Observational study of gene-disease association. (HuGE Navigator)
16829344 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16822320 Observational study of gene-disease association. (HuGE Navigator)
16822320 carriers of the 447X allele displayed significantly lower TG, low-density lipoprotein cholesterol & TG/high-density lipoprotein cholesterol ratio; these findings suggest a role for the S447X polymorphism in combined hyperlipidemia
16813599 Observational study of gene-disease association. (HuGE Navigator)
16813599 LPL 447X-containing genotypes (447X+) were significantly decreased in diabetic nephropathy.
16799404 Observational study of gene-disease association. (HuGE Navigator)
16799404 HindIII and PvuII polymorphisms seem to exert a modulating role on lipid profile particularly in male type 2 diabetees, contributing to increase the risk of macrovascular events.
16776623 Observational study of gene-disease association. (HuGE Navigator)
16770077 Observational study of gene-disease association. (HuGE Navigator)
16763159 Observational study of gene-disease association. (HuGE Navigator)
16755277 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16755277 LPL may influence atherosclerosis risk through pleiotropic effects on each aspect of the metabolic syndrome
16741292 Meta-analysis of gene-disease association. (HuGE Navigator)
16702309 Observational study of gene-disease association. (HuGE Navigator)
16651467 An N291S lipoprotein lipase gene polymorphism was positively associated with increased risk of venous thromboembolism.
16635607 Observational study of gene-disease association. (HuGE Navigator)
16630553 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16630553 These results reveal the importance of genetic screening for LPL gene mutations D9N and S447X in a population at risk to develop hypertriglyceridemia.
16552397 Observational study of gene-disease association. (HuGE Navigator)
16552397 Results suggest that LPL gene S447X polymorphism modifies the relation between central obesity and serum lipids.
16544732 Observational study of gene-disease association. (HuGE Navigator)
16542392 Observational study of gene-disease association. (HuGE Navigator)
16534528 Observational study of gene-disease association. (HuGE Navigator)
16519597 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
16517593 RAP binds to LPL with high affinity both in purified systems and cell extracts and RAP-deficient adipocytes secrete poorly assembled LPL
16466345 Mitochondrial Ca2+ transfer essentially contributes to Ca(2+)-dependent maturation of LPL in the ER and its subsequent secretion during cell stimulation with an IP3-generating agonist.
16460718 L252V mutation in the LPL gene is a common mutation in Chinese with familial hyperchylomicronemia syndrome
16451134 Observational study of gene-disease association. (HuGE Navigator)
16449872 No significant relationship between HDL cholesterol levels and C-514T polymorphism was found even after adjusting for age, body mass index and blood pressure.
16446009 Basal bolus insulin therapyenhances preheparin LPL mass, accompanied by antiatherogenic changes in glucose and lipid metabolism in type 2 diabetes.
16431216 These results suggest that the homozygous initiator codon mutation rather than the heterozygous LPL-242 alteration was mainly responsible for the patient phenotypes.
16430904 Observational study of gene-disease association. (HuGE Navigator)
16430904 our results are consistent with the previously reported role of CETP and LPL genetic variants in cardiovascular risk and the possible modulation of the association between hypertension and carotid IMT by APOCIII Sst-1 variant.
16419488 Observational study of gene-disease association. (HuGE Navigator)
16419488 results suggest that genetic variations at LPL and ApoB loci are among the factors contributing to the variability in response to lipid parameters to therapy in Type 2 diabetes.
16418216 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16416313 Observational study of gene-disease association. (HuGE Navigator)
16378107 Observational study of gene-disease association. (HuGE Navigator)
16369102 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16364275 Observational study of gene-disease association. (HuGE Navigator)
16357806 Serum levels are lower in type 2 diabetes than in normal persons.
16353345 lipoprotein lipase has roles in body composition and body fat distribution that could relate to the development of obesity or the maintenance of normal body weight
16343038 Observational study of gene-disease association. (HuGE Navigator)
16343038 Results show that the H- allele of LPL HindIII polymorphism might have a small effect on apoB levels in the Central European Caucasian population with dyslipidemia of metabolic syndrome.
16256241 LPL-deficient subjects with hypertriglyceridemia displayed an enhanced glucose-stimulated insulin response as well as lower blood glucose levels.
16253639 role for increased ligand action of LPL in LPLS447X carriers contributing to the cardiovascular protection in carriers of this mutation
16205020 Observational study of gene-disease association. (HuGE Navigator)
16195478 Enhanced TRL conversion and enhanced LDL removal combined with increased preheparin LPL concentration suggest increased enzymatic consequences as well as increased nonenzymatic consequences of LPL in LPLS447X carriers
16179346 Ca2+-dependent control of LPL dimerization might be involved in the normal post-translational regulation of LPL activity
16168296 Observational study of gene-disease association. (HuGE Navigator)
16142021 Early recognition of severe hypertriglyceridemia in pregnancy may be caused by heterozygosity of this enzyme.
16141008 Observational study of gene-disease association. (HuGE Navigator)
16135440 Observational study of gene-disease association. (HuGE Navigator)
16132104 Observational study of gene-disease association. (HuGE Navigator)
16132104 LPL variants may play a causal role in the development of hypertension in Taiwan Han Chinese
16122151 Plasma adiponectin appears to be a determinant of plasma triglycerides via an effect on LPL activity
16106048 Observational study of gene-disease association. (HuGE Navigator)
16086925 Observational study of gene-disease association. (HuGE Navigator)
16030523 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16029634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16015281 Observational study of gene-disease association. (HuGE Navigator)
16013913 Observational study of gene-disease association. (HuGE Navigator)
15994321 Data show that lipoprotein lipase suppressed tumor necrosis factor-alpha-induced gene expression, and enhanced interferon-gamma-induced gene expression, in human aortic endothelial cells.
15979432 Observational study of gene-disease association. (HuGE Navigator)
15961789 Observational study of gene-disease association. (HuGE Navigator)
15939061 An increase in the amount of LPL bound to LDL suggests an important mechanism to facilitate the uptake of diabetic LDL by endothelial proteoglycans and collagen in the atherosclerotic plaque.
15928243 variation in the 3' untranslated region of LPL affects LPL expression and activity, consequently influencing risk of atherosclerosis and insulin resistance
15896905 Observational study of gene-disease association. (HuGE Navigator)
15878772 A homozygote missense mutation (204 Asp (GAC)-Glu (GAG)) was found in exon 5 of the LPL gene in a hypertriglyeridemia patient. Triolein-hydrolyzing activity of this LPL was much higher than that of wild-type.
15858619 The Expression of LPL mRNA as well as protein was highly restricted to leukemic B cells.
15857159 Observational study of gene-disease association. (HuGE Navigator)
15802535 quantification of LPL and ADAM29 gene expression is a strong prognostic indicator in CLL, providing better prognostic assessment than ZAP-70 in advanced stages of the disease
15795426 Increased expression after weight loss may contribute to lower plasma ldl cholesterol and triglycerides in obese premenopausal women.
15793775 The lipoprotein lipase H-X haplotype was one of the protective factors of dyslipidemia of metabolic syndrome in hypertensive patients.
15793775 Observational study of gene-disease association. (HuGE Navigator)
15764642 Observational study of gene-disease association. (HuGE Navigator)
15749185 Observational study of gene-disease association. (HuGE Navigator)
15749185 The polymorphisms of intron 8 in lipoprotein lipase influence the blood-lipid metabolism, induce blood vessel rebuilding and play an important role in the invasion and development of Essential Hypertension.
15721013 macrophage-derived LPL in the arterial wall is pro-atherogenic, possibly via the enhancement of foam cell formation during atherogenesis.
15699916 Observational study of gene-disease association. (HuGE Navigator)
15696473 The allelic frequencies of HindIII (-) and (+) allele of LPL was 18.9% and 81.1%; and of PvuII(+) and (-) allele of LPL, was 66.0% and 34.0%, respectively.
15696473 Observational study of genotype prevalence. (HuGE Navigator)
15657615 Observational study of gene-disease association. (HuGE Navigator)
15657615 Single Nucleotide Polymorphisms in Lipoprotein Lipase gene is associated with variation in plasma triglyceride levels Coronary Arteriosclerosis
15637076 Beta-cell LPL has two physiologically relevant effects in islets, the inverse regulation of glucose metabolism and the independent mediation of insulin secretion through effects distal to membrane depolarization.
15608561 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15562208 LPL may represent a link between low adiponectin levels and dyslipidemia in both nondiabetic individuals and patients with type 2 diabetes.
15545743 Observational study of gene-disease association. (HuGE Navigator)
15543643 Observational study of gene-disease association. (HuGE Navigator)
15386377 Observational study of gene-disease association. (HuGE Navigator)
15356086 Observational study of gene-disease association. (HuGE Navigator)
15331147 Observational study of gene-disease association. (HuGE Navigator)
15331147 The lipoprotein lipase allele significantly increases the risk of developing Alzheimer's disease , and the risk is mostly associated with the H+H+ genotype.
15292372 Observational study of gene-disease association. (HuGE Navigator)
15292372 the lipoprotein lipase X447 mutant allele may have a role in preventing myocardial infarct risk
15292370 Observational study of gene-disease association. (HuGE Navigator)
15292370 mean LDL particle diameter was smaller in LPL N9 carriers; the LPL N9 and S291 alleles are more frequent in CHD-free men with normal HDL-C, whereas the X447 allele is less frequent; the N9 allele is associated with the LDL subclass response to gemfibrozil
15270617 Observational study of gene-disease association. (HuGE Navigator)
15257172 Observational study of gene-disease association. (HuGE Navigator)
15257172 high concentration of triglyceride and/or low concentration of HDL-cholesterol are associated with high blood pressure in hypertensive patients with the X447 allele of the LPL gene.
15256516 Observational study of gene-disease association. (HuGE Navigator)
15253101 SNP analysis did not provide substantial evidence of an association between polymorphisms in the LPL gene and hypertension status and/or blood pressure levels in Chinese
15221136 Increased LPL activity improves insulin resistance and reduces adipose accumulation in transgenic rabbits.
15202783 In Polish LPL-H (G) allele carriers, obesity correlated with free fatty acid tolerance in males, and insulin resistance in females.
15189363 Observational study of gene-disease association. (HuGE Navigator)
15155715 In the ET state, only the gender difference in mLPL mRNA persisted. FAT/CD36 protein in muscle was higher in women than in men, irrespective of training status.
15135251 Observational study of gene-disease association. (HuGE Navigator)
15127290 quantitative-transmission/disequilibrium-test analyses showed that there was linkage between DBP and two single nucleotide polymorphisms in the LPL gene
15115692 W86R mutation was the reason for the production of nonfunctional LPL and consequently triacylglycerol (TG) exceeding 15 mmol/l
15076187 Observational study of gene-disease association. (HuGE Navigator)
15076187 APOC3, LPL and GpIIIa genes were found to be associated with BP levels. The contributions of these genes, although modest, are consistent with the polygenic nature of blood pressure levels.
15060087 X447 allele at the LPL locus is common and associated with a less atherogenic lipid profile in Asian populations
15051515 Data show that human lipoprotein lipase significantly inhibited spontaneous human natural killer cells, but not lymphokine-activated killer cytotoxic activity against bovine pulmonary endothelial cells.
15019539 Observational study of gene-disease association. (HuGE Navigator)
14988305 Activity may explain the difference in LDL lipoprotein size in diabetic and nondiabetic people.
14988233 LPL-mediated fatty acid uptake is an inefficient process, but may be more efficient in muscle than in adipose tissue.
14984315 both hyperglycemia and hyperinsulinemia plus hyperglycemia reduced LPL activity to 60 %
14967813 TRL-bound LPL activity increases in the postprandial state and is strongly reduced in type 2 diabetes, contributing to postprandial hypertriglyceridemia
14764824 Macrophage LPL activity correlated with body mass index and fat mass. Incubation of patient macrophages with IGF-I for 24 h or differentiation of monocytes from GH-deficient patients into macrophages in presence of this growth factor decreased LPL.
14693718 Variation in the LPL gene plays a role in determining insulin resistance in Mexican Americans.
14669227 Observational study of gene-disease association. (HuGE Navigator)
14660566 results imply that systemic elevation of lipoprotein lipase expression may be potentially useful for the treatment of hyperlipidemias, obesity, and insulin resistance
14581156 In Japanese, poorly controlled type 2 diabetic men had more unfavorable lipid profile than did women counterparts, which may be associated with decreased plasma LPL levels.
14580165 Observational study of gene-disease association. (HuGE Navigator)
14580156 Observational study of gene-disease association. (HuGE Navigator)
14570890 Muscle can synthesize tethered, dimeric LpL, but efficient production of this enzyme leading to secretion, and physiological function appears to favor secretion of a noncovalent dimer composed of monomeric subunits.
14564687 These results by showing modulation of association between S447X variant of the LPL gene and serum TG by C-514T variant of the HL gene underscore the importance of gene-gene interactions in the assessment of genetic effects on complex traits
14553962 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12964943 Observational study of gene-disease association. (HuGE Navigator)
12919138 Observational study of gene-disease association. (HuGE Navigator)
12915220 did not find significant effects of lipoprotein lipase HindIII or PvuII polymorphisms on the fasting lipids but HindIII variation was associated with higher triglyceride postprandial peak
12905705 Observational study of gene-disease association. (HuGE Navigator)
12889841 Observational study of gene-disease association. (HuGE Navigator)
12876415 Observational study of gene-disease association. (HuGE Navigator)
12866915 Observational study of gene-disease association. (HuGE Navigator)
12865761 Observational study of gene-disease association. (HuGE Navigator)
12865761 lipoprotein lipase has a protective role against coronary artery disease in Mexican-Americans
12862202 findings of variation near the LPL gene support the proposition that a region near the lipoprotein lipase gene or the lipoprotein lipase gene itself might contribute to the individual blood pressure variation in Chinese
12818414 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12818414 LPL 44X alleles were associated with moderately increased LDL peak particle size.
12793009 Observational study of gene-environment interaction. (HuGE Navigator)
12782148 LPL lipolysis of emulsion triolein was retarded in chylomicron-free human plasma compared with the hydrolysis activated by isolated apolipoprotein C-II.
12777470 LPL enzyme activities in 28 healthy subjects with well-controlled Type 1 diabetes, and their relationship with Lp(A-I) and Lp(A-I,A-II)
12747600 Observational study of gene-disease association. (HuGE Navigator)
12747600 Lipoprotein lipase gene polymorphisms might be involved in predisposition to coronary artery disease
12746411 LPL gene and associated regions might contribute to individual blood pressure variation and hypertension in the Chinese population
12740382 data indicate an important role of endoplasmic reticulum-based chaperones for the folding/dimerization of lipoprotein lipase
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12708905 Observational study of gene-disease association. (HuGE Navigator)
12704407 Observational study of gene-disease association. (HuGE Navigator)
12690214 Observational study of gene-disease association. (HuGE Navigator)
12690214 The LPL D9N genotype was a significant predictor of both baseline carotid plaque area and progression. Heterozygotes for the N9 allele had higher values than did LPL D9/D9 homozygotes. D9N genotype may be a determinant of atherosclerosis.
12687649 Observational study of gene-disease association. (HuGE Navigator)
12687649 the LPL association with lipid profile is more likely attributable to the functional S447X rather than the nonfunctional exon 10 SNP
12679477 results demonstrate a direct effect of prolactin, via functional prolactin receptors, in reducing the lipoprotein lipase activity in human adipose tissue
12655575 Observational study of gene-disease association. (HuGE Navigator)
12655575 LPL enzyme deficiency causes elevated plasma triglyceride level and subsequent insulin resistance; increased free fatty acids combined with insulin resistance promote gluconeogenesis and hyperglycemia, a vicious circle leading to type 2 diabetes.
12647273 Observational study of gene-disease association. (HuGE Navigator)
12647273 H+ allele of the lipoprotein lipase gene HindIII polymorphism is associated with higher plasma triglyceride and lower HDL-cholesterol levels in Chinese patients with early-onset diabetes
12636935 Observational study of gene-disease association. (HuGE Navigator)
12573449 conclude that type IIB VLDL-1 and VLDL-2 induce triglyceride accumulation in monocyte-macrophages primarily by the lipolytic action of LPL, which may involve stabilization and activation of the enzyme, rather than modulation of enzyme production
12544508 Observational study of gene-environment interaction. (HuGE Navigator)
12514935 Observational study of gene-disease association. (HuGE Navigator)
12501246 LPL could play a key role in the differentiation of Neuro-2A cells and in the pathophysiological effects of oxidative stress in several neurodegenerative disorders
12483461 LPL has a role in atherosclerosis, chylomicronaemia, obesity, Alzheimer's disease, and dyslipidaemia associated with diabetes, insulin resistance, and infection [review]
12446192 Observational study of gene-disease association. (HuGE Navigator)
12408999 Observational study of gene-disease association. (HuGE Navigator)
12408999 some single-nucleotide polymorphisms in the LPL gene among Chinese associated with abnormal lipid and lipoprotein profiles and predisposition to coronary heart disease, and they are gender-specific.
12370850 variations in genes affecting the removal rate of triglycerides (TG) from plasma significantly influence the lipid phenotypic expression of familial combined hyperlipidemia
12230584 molecular modeling of its dimeric structure
12226739 LPL is bound to postprandial triglyceride-rich lipoproteins and mediates their hepatic clearance in vivo.
12208477 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
12208477 The S447X mutation is associated with anti-atherogenic effects on TG and HDL cholesterol in both genders, and with a moderate protective effect on risk of ischemic heart disease in men.
12174215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12164879 Observational study of gene-disease association. (HuGE Navigator)
12133567 Observational study of gene-disease association. (HuGE Navigator)
12133533 Observational study of gene-disease association. (HuGE Navigator)
12117735 Observational study of gene-disease association. (HuGE Navigator)
12107736 Observational study of gene-disease association. (HuGE Navigator)
12107736 Variants in gene relate to presence and degree of microalbuminuria in Type II diabetes
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12044583 Observational study of gene-disease association. (HuGE Navigator)
12042669 Observational study of gene-environment interaction. (HuGE Navigator)
11996946 Observational study of gene-disease association. (HuGE Navigator)
11996946 results suggest that the nature of the mutation in the LPL gene modifies the relationship of HDL particle size to other metabolic variables and secondary factors such as abdominal obesity and gender.
11947965 Low mass in preheparin serum of type 2 diabetes mellitus patients and its recovery with insulin therapy.
11921083 Observational study of gene-disease association. (HuGE Navigator)
11899831 Observational study of gene-disease association. (HuGE Navigator)
11897170 Observational study of gene-disease association. (HuGE Navigator)
11897170 lipoprotein lipase cannot be a major factor in pathogenesis of Alzheimer's disease
11893778 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11893776 Spontaneously occurring dissociation of LPL dimer into monomers is accelerated in exon 5 mutants, resulting in conformational changes which result in loss of LPL catalytic activity.
11852057 Peroxisome proliferator-activated receptor (PPARalpha and PPARgamma) agonists decrease lipoprotein lipase secretion and glycated LDL uptake by human macrophages.
11796709 Maturation of lipoprotein lipase in the endoplasmic reticulum
11796707 role of Sp1 and Sp3 in interferon-gamma mediated suppression of gene transcription
11730816 Observational study of gene-disease association. (HuGE Navigator)
11714860 Observational study of gene-disease association. (HuGE Navigator)
11714857 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11711487 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11702219 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11702052 Observational study of gene-disease association. (HuGE Navigator)
11683775 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11680797 Observational study of gene-disease association. (HuGE Navigator)
11605530 Observational study of gene-disease association. (HuGE Navigator)
11593500 Observational study of gene-disease association. (HuGE Navigator)
11534394 Observational study of gene-disease association. (HuGE Navigator)
11533368 Observational study of gene-disease association. (HuGE Navigator)
11500192 Observational study of gene-disease association. (HuGE Navigator)
11484171 Observational study of gene-disease association. (HuGE Navigator)
11441189 Observational study of gene-disease association. (HuGE Navigator)
11427211 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11395037 Observational study of gene-disease association. (HuGE Navigator)
11341749 Observational study of genotype prevalence. (HuGE Navigator)
11316129 Observational study of gene-disease association. (HuGE Navigator)
11284423 Observational study of gene-disease association. (HuGE Navigator)
11229437 Observational study of gene-disease association. (HuGE Navigator)
11205691 Observational study of gene-disease association. (HuGE Navigator)
11194013 Observational study of gene-disease association. (HuGE Navigator)
11171287 Observational study of gene-disease association. (HuGE Navigator)
11140837 Observational study of gene-disease association. (HuGE Navigator)
11132601 Observational study of gene-disease association. (HuGE Navigator)
11126401 Observational study of gene-disease association. (HuGE Navigator)
11096142 Observational study of gene-disease association. (HuGE Navigator)
11073182 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFN      1 - 70
HSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFIN     71 - 140
WMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLH    141 - 210
TFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLL    211 - 280
NEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFS    281 - 350
GTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW    351 - 420
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG                   421 - 475
//

Text Mined References (665)

PMID Year Title
27578112 Identification and characterization of two novel mutations in the LPL gene causing type I hyperlipoproteinemia.
27159952 2016 [ESTIMATING THE EFFECTIVENESS OF HYPOLIPIDEMIC THERAPY WITH ROSUVASTATIN IN PATIENTS WITH CORONARY HEART DISEASE DEPENDING ON THE GENOTYPE OF LIPOPROTEIN LIPASE].
26975783 2016 Meta-analyses of four polymorphisms of lipoprotein lipase associated with the risk of Alzheimer's disease.
26503844 2015 CETP/LPL/LIPC gene polymorphisms and susceptibility to age-related macular degeneration.
26420199 2015 Diets high in carbohydrate may not be appropriate for rs328 G carriers with the metabolic syndrome.
26388538 2015 Acute alcohol consumption downregulates lipoprotein lipase activity in vivo.
26370976 2015 Polymorphisms in the LPL and CETP Genes and Haplotype in the ESR1 Gene Are Associated with Metabolic Syndrome in Women from Southwestern Mexico.
26342331 2015 Contribution of mutations in low density lipoprotein receptor (LDLR) and lipoprotein lipase (LPL) genes to familial combined hyperlipidemia (FCHL): a reappraisal by using a resequencing approach.
26214456 2015 Relationship between a lipoprotein lipase gene polymorphism in placental tissue and insulin resistance in patients with gestational diabetes mellitus.
26188224 Study of common variants of the apolipoprotein E and lipoprotein lipase genes in patients with coronary heart disease and variable body mass index.
26101956 2015 Polymorphisms in LPL, CETP, and HL protect HIV-infected patients from atherogenic dyslipidemia in an allele-dose-dependent manner.
26026161 2015 A Pressure-dependent Model for the Regulation of Lipoprotein Lipase by Apolipoprotein C-II.
26025183 2015 Association of lipoprotein lipase gene with coronary heart disease in Sudanese population.
25995285 2015 Lipoprotein lipase and atherosclerosis.
25966443 2015 Spectrum of mutations of the LPL gene identified in Italy in patients with severe hypertriglyceridemia.
25948680 2015 Maternal High-Fat Feeding Increases Placental Lipoprotein Lipase Activity by Reducing SIRT1 Expression in Mice.
25897955 2015 Atherogenic dyslipidemia in children: evaluation of clinical, biochemical and genetic aspects.
25811490 2015 Lipoprotein lipase SNPs rs13702 and rs301 correlate with clinical outcome in chronic lymphocytic leukemia patients.
25809647 2015 Impact of LPL gene rs283 polymorphism on exercise-induced changes in metabolism of obese adolescents and the regulatory mechanisms behind it.
25784555 2015 Increasing adipocyte lipoprotein lipase improves glucose metabolism in high fat diet-induced obesity.
25626708 2015 Resequencing of LPL in African Blacks and associations with lipoprotein-lipid levels.
25597500 2015 Lipoprotein lipase and angiopoietin-like 4 - Cardiomyocyte secretory proteins that regulate metabolism during diabetic heart disease.
25595992 2015 Lipoprotein lipase deficiency leads to ?-synuclein aggregation and ubiquitin C-terminal hydrolase L1 reduction.
25589507 2015 The tissue distribution of lipoprotein lipase determines where chylomicrons bind.
25579610 2015 The lipoprotein lipase S447X and cholesteryl ester transfer protein rs5882 polymorphisms and their relationship with lipid profile in human serum of obese individuals.
25445417 2015 The role of circulating lipoprotein lipase and adiponectin on the particle size of remnant lipoproteins in patients with diabetes mellitus and metabolic syndrome.
25387803 2015 GPIHBP1 missense mutations often cause multimerization of GPIHBP1 and thereby prevent lipoprotein lipase binding.
25239670 2015 Comparison of the effect of post-heparin and pre-heparin lipoprotein lipase and hepatic triglyceride lipase on remnant lipoprotein metabolism.
25156894 2014 Lipoprotein lipase variants interact with polyunsaturated fatty acids for obesity traits in women: replication in two populations.
25149060 2014 MicroRNA-590 attenuates lipid accumulation and pro-inflammatory cytokine secretion by targeting lipoprotein lipase gene in human THP-1 macrophages.
25131724 2014 Quantification and genotyping of lipoprotein lipase in patients with diabetic lipaemia.
25073452 2014 Associations between APOE and low-density lipoprotein cholesterol genotypes and cognitive and physical capability: the HALCyon programme.
25066055 2014 The ER-associated degradation adaptor protein Sel1L regulates LPL secretion and lipid metabolism.
24990426 2014 MicroRNA-410 regulated lipoprotein lipase variant rs13702 is associated with stroke incidence and modulated by diet in the randomized controlled PREDIMED trial.
24988117 2015 Role of 3 lipoprotein lipase variants in triglycerides in children receiving highly active antiretroviral therapy.
24974629 2014 [Lack of association between the S447X variant of the lipoprotein lipase gene and plasma lipids. A preliminary study].
24905278 2014 Association of adiponectin with serum preheparin lipoprotein lipase mass in women independent of fat mass and distribution, insulin resistance, and inflammation.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24847699 2014 Placental lipoprotein lipase DNA methylation levels are associated with gestational diabetes mellitus and maternal and cord blood lipid profiles.
24793350 Genotype-phenotype relationships in patients with type I hyperlipoproteinemia.
24762672 2014 Associations of lipoprotein lipase gene rs326 with changes of lipid profiles after a high-carbohydrate and low-fat diet in healthy Chinese Han youth.
24704626 2014 Rare LPL gene variants attenuate triglyceride reduction and HDL cholesterol increase in response to fenofibric acid therapy in individuals with mixed dyslipidemia.
24704550 2014 Equivalent binding of wild-type lipoprotein lipase (LPL) and S447X-LPL to GPIHBP1, the endothelial cell LPL transporter.
24646025 2014 A novel lipoprotein lipase gene missense mutation in Chinese patients with severe hypertriglyceridemia and pancreatitis.
24591733 2014 Clinical features and genetic analysis of three patients with severe hypertriglyceridaemia.
24462462 2014 HindIII polymorphism in the lipoprotein lipase gene and hypertensive intracerebral hemorrhage in the Chinese Han population.
24458708 2014 Role of SN1 lipases on plasma lipids in metabolic syndrome and obesity.
24407533 2013 Lipoprotein lipase gene HindIII polymorphism and risk of myocardial infarction in South Indian population.
24400599 2014 Newborn LpL (Ser447Stop, Asn291Ser) genotypes and the interaction with maternal genotypes influence the risk for different types of preeclampsia: modulating effect on lipid profile and pregnancy outcome.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
24340925 2013 [Polymorphisms Ser447Ter of lipoprotein-lipase gene, Cys112Arg and Arg158Cys of apolipoprotein E gene in patients with obesity].
24314358 Resequencing the untranslated regions of the lipoprotein lipase (LPL) gene reveals that variants in microRNA target sequences are associated with triglyceride levels.
24308220 2013 Effects of lipoprotein lipase and peroxisome proliferator-activated receptor-gamma gene variants on metabolic syndrome traits.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24223199 2013 Association of HDL-related loci with age-related macular degeneration and plasma lutein and zeaxanthin: the Alienor study.
24212298 2014 Lipoprotein lipase gene sequencing and plasma lipid profile.
24205968 2014 LPL Ser447Ter and Asn291Ser variants in Romanians: associations with preeclampsia - implications on lipid profile and prognosis.
24121499 2013 Apolipoproteins C-I and C-III inhibit lipoprotein lipase activity by displacement of the enzyme from lipid droplets.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24081181 2014 Lipoprotein lipase activity in heterozygotes for lipoprotein lipase gene mutations reveals a gender bias.
24023261 2013 THOC5: a novel gene involved in HDL-cholesterol metabolism.
24009459 2013 Gestational hyperlipidemia and acute pancreatitis with underlying partial lipoprotein lipase deficiency and apolipoprotein E3/E2 genotype.
24004859 2013 Lipoprotein lipase (LPL) is associated with neurite pathology and its levels are markedly reduced in the dentate gyrus of Alzheimer's disease brains.
23991054 2013 Comparative analyses of lipoprotein lipase, hepatic lipase, and endothelial lipase, and their binding properties with known inhibitors.
23902956 2013 A lipoprotein lipase gene polymorphism interacts with consumption of alcohol and unsaturated fat to modulate serum HDL-cholesterol concentrations.
23880163 2013 Lipoprotein lipase in non-small cell lung cancer tissue is highly expressed in a subpopulation of tumor-associated macrophages.
23761384 2013 Familial lipoprotein lipase deficiency: a case of compound heterozygosity of a novel duplication (R44Kfs*4) and a common mutation (N291S) in the lipoprotein lipase gene.
23735640 2013 Lipoprotein lipase gene polymorphism rs1059611 functionally influences serum lipid concentrations.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23661675 2013 Angptl3 deficiency is associated with increased insulin sensitivity, lipoprotein lipase activity, and decreased serum free fatty acids.
23623643 2013 DNA methylation variations at CETP and LPL gene promoter loci: new molecular biomarkers associated with blood lipid profile variability.
23614796 2013 Methylation status regulates lipoprotein lipase expression in chronic lymphocytic leukemia.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23478142 2013 Lipoprotein lipase in chronic lymphocytic leukaemia - strong biomarker with lack of functional significance.
23377670 2013 Synergistic effect between lipoprotein lipase and apolipoprotein C3 genes in determining the severity of coronary artery disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23344322 2013 Association of lipoprotein lipase polymorphism rs2197089 with serum lipid concentrations and LPL gene expression.
23320821 2013 Lipoprotein lipase links vitamin D, insulin resistance, and type 2 diabetes: a cross-sectional epidemiological study.
23089926 2012 Association of the HindIII and S447X polymorphisms in LPL gene with hypertension and type 2 diabetes in Mexican families.
23056264 2012 Angiopoietin-like 4 mediates PPAR delta effect on lipoprotein lipase-dependent fatty acid uptake but not on beta-oxidation in myotubes.
23008484 2012 Assessing mechanisms of GPIHBP1 and lipoprotein lipase movement across endothelial cells.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22837712 2012 DNA polymorphisms of the lipoprotein lipase gene and their association with coronary artery disease in the Saudi population.
22828442 2013 Lipoprotein lipase expression in unmutated CLL patients is the consequence of a demethylation process induced by the microenvironment.
22820186 2012 Inactivation of lipoprotein lipase occurs on the surface of THP-1 macrophages where oligomers of angiopoietin-like protein 4 are formed.
22810051 2012 Genetic variation in MDR1, LPL and eNOS genes and the response to atorvastatin treatment in ischemic stroke.
22773878 2012 Fatty acids bind tightly to the N-terminal domain of angiopoietin-like protein 4 and modulate its interaction with lipoprotein lipase.
22772754 2012 Human ATP-binding cassette G1 controls macrophage lipoprotein lipase bioavailability and promotes foam cell formation.
22729917 2012 Six lipoprotein lipase gene polymorphisms, lipid profile and coronary stenosis in a Tunisian population.
22541364 2012 Association of LPL gene variant and LDL, HDL, VLDL cholesterol and triglyceride levels with ischemic stroke and its subtypes.
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
22368174 2012 Regulation of mitochondrial biogenesis by lipoprotein lipase in muscle of insulin-resistant offspring of parents with type 2 diabetes.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22244040 2012 The lipoprotein lipase (LPL) S447X gain of function variant involves increased mRNA translation.
22239554 2012 Mutations in LPL, APOC2, APOA5, GPIHBP1 and LMF1 in patients with severe hypertriglyceridaemia.
22171074 2012 A genome-wide association and gene-environment interaction study for serum triglycerides levels in a healthy Chinese male population.
22123668 2012 New wrinkles in lipoprotein lipase biology.
22101375 2011 Effects of lipoprotein lipase gene variations, a high-carbohydrate low-fat diet, and gender on serum lipid profiles in healthy Chinese Han youth.
22095987 2012 Apolipoprotein B-100-containing lipoprotein metabolism in subjects with lipoprotein lipase gene mutations.
22078753 2012 Effects of hyperinsulinemia on lipoprotein lipase, angiopoietin-like protein 4, and glycosylphosphatidylinositol-anchored high-density lipoprotein binding protein 1 in subjects with and without type 2 diabetes mellitus.
22018640 2011 Eicosapentaenoic acid administration attenuates the pro-inflammatory properties of VLDL by decreasing its susceptibility to lipoprotein lipase in macrophages.
21980507 2011 Amelioration of hypertriglyceridemia with hypo-alpha-cholesterolemia in LPL deficient mice by hematopoietic cell-derived LPL.
21978733 2013 The g.-469G>A polymorphism in the GPIHBP1 gene promoter is associated with hypertriglyceridemia and has an additive effect on the risk conferred by LPL defective alleles.
21966368 2011 Adipose tissue gene expression of factors related to lipid processing in obesity.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21862952 2011 Association between schizophrenia and single nucleotide polymorphisms in lipoprotein lipase gene in a Han Chinese population.
21854610 2011 Lipoprotein lipase S447X variant associated with VLDL, LDL and HDL diameter clustering in the MetS.
21840003 2011 Genetic variations at the lipoprotein lipase gene influence plasma lipid concentrations and interact with plasma n-6 polyunsaturated fatty acids to modulate lipid metabolism.
21816453 2011 Lipoprotein lipase Ser447Ter polymorphism associated with the risk of ischemic stroke: a meta-analysis.
21722517 2011 [Polymorphisms of lipoprotein lipase gene and their participation in metabolic processes].
21621348 2012 [Association between variants of lipoprotein lipase and coronary heart disease in a Tunisian population].
21518912 2011 Mutations in lipoprotein lipase that block binding to the endothelial cell transporter GPIHBP1.
21508119 2011 LPL is the strongest prognostic factor in a comparative analysis of RNA-based markers in early chronic lymphocytic leukemia.
21499891 2011 Association of lipoprotein lipase and apolipoprotein C-III genes polymorphism with acute myocardial infarction in diabetic patients.
21478160 2011 Assessing the role of the glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1) three-finger domain in binding lipoprotein lipase.
21448664 2011 Lipoprotein lipase (A1127G) gene polymorphism: a case-control association study.
21419757 2011 The HindIII polymorphism in the lipoprotein lipase gene predicts type 2 diabetes risk among Chinese adults.
21398697 2011 Proteolytic processing of angiopoietin-like protein 4 by proprotein convertases modulates its inhibitory effects on lipoprotein lipase activity.
21386085 2011 A bivariate genome-wide approach to metabolic syndrome: STAMPEED consortium.
21385844 2011 SorLA regulates the activity of lipoprotein lipase by intracellular trafficking.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
21252727 2011 Contribution of adiponectin to the cardiometabolic risk of postmenopausal women with loss-of-function lipoprotein lipase gene mutations.
21252145 2011 Physical activity modifies the effect of LPL, LIPC, and CETP polymorphisms on HDL-C levels and the risk of myocardial infarction in women of European ancestry.
21193198 2011 Predictive role of polymorphisms in interleukin-5 receptor alpha-subunit, lipoprotein lipase, integrin A2 and nitric oxide synthase genes on ischemic stroke in type 2 diabetes--an 8-year prospective cohort analysis of 1327 Chinese patients.
21162862 2010 [Association of lipoprotein lipase gene Hind III and S447X polymorphisms in metabolic syndrome patients among Kazakh and Han ethnics from Xinjiang].
21159338 2011 Rare variants in the lipoprotein lipase (LPL) gene are common in hypertriglyceridemia but rare in Type III hyperlipidemia.
21146168 2011 LPL polymorphism (D9N) predicts cardiovascular disease risk directly and through interaction with CETP polymorphism (TaqIB) in women with high HDL cholesterol and CRP.
21127884 2011 The S447X variant of lipoprotein lipase gene is inversely associated with severity of coronary artery disease.
21060192 2010 Serum lipase concentration in chronic hemodialysis patients.
21044743 2010 Increased fatty acid synthase activity in non-small cell lung cancer tissue is a weaker predictor of shorter patient survival than increased lipoprotein lipase activity.
20943490 2010 [Meta-analysis of LPL Pvu? polymorphism with hyperlipoidemia and coronary heart disease in the Chinese population.].
20926921 2011 Fasting and post-prandial adipose tissue lipoprotein lipase and hormone-sensitive lipase in obesity and type 2 diabetes.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20836743 2011 Variable effects of maternal and paternal-fetal contribution to the risk for preeclampsia combining GSTP1, eNOS, and LPL gene polymorphisms.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20693566 2010 GIP increases human adipocyte LPL expression through CREB and TORC2-mediated trans-activation of the LPL gene.
20691829 2010 Joint effects of common genetic variants from multiple genes and pathways on the risk of premature coronary artery disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20657596 2010 Excess of rare variants in genes identified by genome-wide association study of hypertriglyceridemia.
20650961 2010 Application of statistical and functional methodologies for the investigation of genetic determinants of coronary heart disease biomarkers: lipoprotein lipase genotype and plasma triglycerides as an exemplar.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616609 2010 Impact of walking on adipose tissue lipoprotein lipase activity and expression in pre- and postmenopausal women.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20596061 2011 Meta-based association of the lipoprotein lipase gene S447X variant with hypertension and blood pressure variation.
20595410 2010 Association of angiopoietin-like protein 3 with hepatic triglyceride lipase and lipoprotein lipase activities in human plasma.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20581395 2010 Angiopoietin-like protein 3 inhibits lipoprotein lipase activity through enhancing its cleavage by proprotein convertases.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20506644 2010 [Effects of lipoprotein lipase gene Ser447stop polymorphism on changes of serum lipid ratios induced by high-carbohydrate/low-fat diet in healthy youth].
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20430250 2010 Associations for lipoprotein lipase and peroxisome proliferator-activated receptor-gamma gene and coronary artery disease in an Indian population.
20429872 2010 Additive effects of LPL, APOA5 and APOE variant combinations on triglyceride levels and hypertriglyceridemia: results of the ICARIA genetic sub-study.
20421589 2010 VLDL hydrolysis by LPL activates PPAR-alpha through generation of unbound fatty acids.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20410100 2010 Genetic variation in APOJ, LPL, and TNFRSF10B affects plasma fatty acid distribution in Alaskan Eskimos.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20400780 2010 Candidate gene association resource (CARe): design, methods, and proof of concept.
20385819 2010 Genetic variants near TIMP3 and high-density lipoprotein-associated loci influence susceptibility to age-related macular degeneration.
20350420 2010 [Lipoprotein lipase gene mutations and the risk of cardiovascular diseases in children with obesity].
20347446 2010 Relationship between common lipoprotein lipase gene sequence variants, hyperinsulinemia, and risk of ischemic heart disease: A population-based study.
20235787 2010 Common sequence variants in pharmacodynamic and pharmacokinetic pathway-related genes conferring LDL cholesterol response to statins.
20228263 2010 High expression of lymphocyte-activation gene 3 (LAG3) in chronic lymphocytic leukemia cells is associated with unmutated immunoglobulin variable heavy chain region (IGHV) gene and reduced treatment-free survival.
20167577 2010 Analysis of lipid pathway genes indicates association of sequence variation near SREBF1/TOM1L2/ATPAF2 with dementia risk.
20160193 2010 Investigation of variants identified in caucasian genome-wide association studies for plasma high-density lipoprotein cholesterol and triglycerides levels in Mexican dyslipidemic study samples.
20150529 2010 Associations of lipoprotein lipase gene polymorphisms with longitudinal plasma lipid trends in young adults: The Coronary Artery Risk Development in Young Adults (CARDIA) study.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20124439 2010 Chylomicronemia with low postheparin lipoprotein lipase levels in the setting of GPIHBP1 defects.
20108206 2010 Association of lipase lipoprotein polymorphisms with high-density lipoprotein and triglycerides in elderly men.
20099167 2010 [Relationship of gallstone formation after radical gastrectomy with the polymorphisms of apolipoprotein B Xba I and lipoprotein lipase Hind III gene].
20092038 2010 Association of lipase lipoprotein polymorphisms with high-density lipoprotein and triglycerides in elderly men.
20075597 2010 Twelve-week jogging training increases pre-heparin serum lipoprotein lipase concentrations in overweight/obese middle-aged men.
20031591 2009 Association of blood lipids with common DNA sequence variants at 19 genetic loci in the multiethnic United States National Health and Nutrition Examination Survey III.
20031551 2008 Pharmacogenetic predictors of statin-mediated low-density lipoprotein cholesterol reduction and dose response.
20031538 2008 Genome-wide association analysis of high-density lipoprotein cholesterol in the population-based KORA study sheds new light on intergenic regions.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910634 2010 Human apolipoprotein A-II determines plasma triglycerides by regulating lipoprotein lipase activity and high-density lipoprotein proteome.
19899640 [Complex analysis of genetic predisposition to ischemic stroke in Russians].
19888660 2009 Genetic determinants of serum lipid levels in Chinese subjects: a population-based study in Shanghai, China.
19884647 2010 Air pollution, obesity, genes and cellular adhesion molecules.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19875996 2010 Postabsorptive VLDL-TG fatty acid storage in adipose tissue in lean and obese women.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19818126 2009 Single nucleotide polymorphisms in obesity-related genes and all-cause and cause-specific mortality: a prospective cohort study.
19783858 2009 Lipase maturation factor LMF1, membrane topology and interaction with lipase proteins in the endoplasmic reticulum.
19780863 2010 Lipoprotein lipase and endothelial lipase in human testis and in germ cell neoplasms.
19773416 2010 A gene score of nine LDL and HDL regulating genes is associated with fluvastatin-induced cholesterol changes in women.
19772655 2009 Genetic association study of selected candidate genes (ApoB, LPL, Leptin) and telomere length in obese and hypertensive individuals.
19766899 2009 Increased lipoprotein lipase activity in non-small cell lung cancer tissue predicts shorter patient survival.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19709746 2010 Lipoprotein lipase is differentially expressed in prognostic subsets of chronic lymphocytic leukemia but displays invariably low catalytical activity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19689828 2009 Nutrigenetics: links between genetic background and response to Mediterranean-type diets.
19664517 2009 Genetic polymorphism of S447X lipoprotein lipase (LPL) and the susceptibility to hypertension.
19656773 2009 A polygenic basis for four classical Fredrickson hyperlipoproteinemia phenotypes that are characterized by hypertriglyceridemia.
19642912 2009 Lipid profiles and associated gene polymorphisms in young Asian Indian patients with acute myocardial infarction and the metabolic syndrome.
19629056 2010 Apolipoprotein A5 and lipoprotein lipase interact to modulate anthropometric measures in Hispanics of Caribbean origin.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19602472 2010 Lipid and endothelium-related genes, ambient particulate matter, and heart rate variability--the VA Normative Aging Study.
19584682 2009 Tacrolimus-induced elevation in plasma triglyceride concentrations after administration to renal transplant patients is partially due to a decrease in lipoprotein lipase activity and plasma concentrations.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19563912 2009 Identification and characterization of a novel 5 bp deletion in a putative insulin response element in the lipoprotein lipase gene.
19558660 2009 Sex-associated effect of CETP and LPL polymorphisms on postprandial lipids in familial hypercholesterolaemia.
19556723 2009 S447X polymorphism in the lipoprotein lipase gene and the adiponectin level in the general population: results from the Mima study.
19542565 2009 GPIHBP1 stabilizes lipoprotein lipase and prevents its inhibition by angiopoietin-like 3 and angiopoietin-like 4.
19534808 2009 Lipoprotein lipase activity and mass, apolipoprotein C-II mass and polymorphisms of apolipoproteins E and A5 in subjects with prior acute hypertriglyceridaemic pancreatitis.
19501493 2010 A composite scoring of genotypes discriminates coronary heart disease risk beyond conventional risk factors in the Boston Puerto Rican Health Study.
19489872 2010 Association of polymorphisms in genes involved in lipoprotein metabolism with plasma concentrations of remnant lipoproteins and HDL subpopulations before and after hormone therapy in postmenopausal women.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19471043 2009 A quantitative assay measuring the function of lipase maturation factor 1.
19428034 2009 Two novel mutations and functional analyses of the CETP and LIPC genes underlying severe hyperalphalipoproteinemia.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19403283 2010 APOE, CETP and LPL genes show strong association with lipid levels in Greek children.
19368142 Associations of lipoprotein lipase S447X and apolipoprotein E genotypes with low-density lipoprotein subfractions in Turkish patients with coronary artery disease.
19367320 2009 Diagnostic value of post-heparin lipase testing in detecting common genetic variants in the LPL and LIPC genes.
19367093 2009 Association study between candidate genes and obesity-related phenotypes using a sample of lumberjacks.
19357293 2009 Presynaptic defects underlying impaired learning and memory function in lipoprotein lipase-deficient mice.
19340428 2009 IGHV gene mutational status and LPL/ADAM29 gene expression as clinical outcome predictors in CLL patients in remission following treatment with oral fludarabine plus cyclophosphamide.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19335919 2009 Small and dense LDL in familial combined hyperlipidemia and N291S polymorphism of the lipoprotein lipase gene.
19299407 2009 Replication of genetic associations with plasma lipoprotein traits in a multiethnic sample.
19295657 2009 Novel LPL mutations associated with lipoprotein lipase deficiency: two case reports and a literature review.
19259048 2008 Association of PvuII polymorphism in the lipoprotein lipase gene with the coronary artery disease in Macedonian population.
19254215 2009 [Association of genetic factors with clinical peculiarities of hypertensive disease in patients with burdened familial anamnesis].
19246456 2009 A highly conserved motif within the NH2-terminal coiled-coil domain of angiopoietin-like protein 4 confers its inhibitory effects on lipoprotein lipase by disrupting the enzyme dimerization.
19207029 2009 Common sequence variant in lipoprotein lipase gene conferring triglyceride response to fibrate treatment.
19191728 2009 Preheparin serum lipoprotein lipase mass interacts with gender, gene polymorphism and, positively, with smoking.
19185650 2009 S447X variant of the lipoprotein lipase gene, lipids, and risk of coronary heart disease in 3 prospective cohort studies.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19167106 2010 Association of three lipoprotein lipase polymorphisms with coronary artery disease in Chinese and Asian Indians.
19155782 2009 The environmental and genetic evidence for the association of hyperlipidemia and hypertension.
19148283 2009 Genetic differences between the determinants of lipid profile phenotypes in African and European Americans: the Jackson Heart Study.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19099922 2008 [Geographical characteristics of single nucleotide polymorphism of candidate genes associated with coronary artery disease in Chinese Han population].
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19052449 2008 Lipoprotein lipase 1595 c/g and hepatic lipase -480 c/t polymorphisms--impact on lipid profile in incident dialysis patients.
19034316 2009 The expression of type III hyperlipoproteinemia: involvement of lipolysis genes.
19034041 2009 Lipoprotein lipase mutation S447X associated with pancreatic calcification and steatorrhea in hyperlipidemic pancreatitis.
19028676 2009 The angiopoietin-like proteins ANGPTL3 and ANGPTL4 inhibit lipoprotein lipase activity through distinct mechanisms.
19018513 2009 The association of common genetic variants in the APOA5, LPL and GCK genes with longitudinal changes in metabolic and cardiovascular traits.
19004026 2009 Genetic and epigenetic inactivation of LPL gene in human prostate cancer.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18986377 2010 Association analyses of genetic polymorphisms of GSTM1, GSTT1, NQO1, NAT2, LPL, PRSS1, PSTI, and CFTR with chronic alcoholic pancreatitis in Japan.
18985010 2008 Association of lipoprotein lipase (LPL) single nucleotide polymorphisms with type 2 diabetes mellitus.
18927546 2008 Lp(a) and risk of recurrent cardiac events in obese postinfarction patients.
18922999 2008 Seven lipoprotein lipase gene polymorphisms, lipid fractions, and coronary disease: a HuGE association review and meta-analysis.
18823627 2009 Association of lipoprotein lipase D9N polymorphism with myocardial infarction in type 2 diabetes: the genetics, outcomes, and lipids in type 2 diabetes (GOLD) study.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18724972 2008 Sex differences in environmental and genetic factors for hypertension.
18693040 2008 Association of the lipoprotein lipase gene T+495G polymorphism with central obesity and serum lipids in a twin study.
18681781 2008 Genetic correlates of olanzapine-induced weight gain in schizophrenia subjects from north India: role of metabolic pathway genes.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18649389 2009 Lipoprotein lipase variants associated with an endophenotype of hypertension: hypertension combined with elevated triglycerides.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18635818 2008 Effects of six APOA5 variants, identified in patients with severe hypertriglyceridemia, on in vitro lipoprotein lipase activity and receptor binding.
18619685 Apolipoprotein E (APOE) and lipoprotein lipase (LPL) gene variants and carotid atherosclerotic lesions in the oldest old: a population-based autopsy study.
18616755 2009 Expression level of lipoprotein lipase in Chinese patients with chronic lymphocytic leukemia and its correlation with other prognostic factors.
18603820 2008 Effect of the angiotensin II receptor antagonist telmisartan on lipoprotein lipase mass in preheparin serum.
18596051 2008 Polygenic determinants of severe hypertriglyceridemia.
18590804 2008 Polymorphisms of the lipoprotein lipase gene are associated with atherosclerotic cerebral infarction in the Chinese.
18535540 2008 Prolactin and insulin ultradian secretion and adipose tissue lipoprotein lipase expression in severely obese women after bariatric surgery.
18534873 Genetic profile identification in clinically localized prostate carcinoma.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18494281 2008 [The relation between gene of lipoprotein-lipase and carrier protein of cholesterol ethers and life duration in patients with chronic cerebral ischemia].
18454146 2008 Common genetic variation near MC4R is associated with waist circumference and insulin resistance.
18449420 2008 Association of ADAMDEC1 haplotype with high factor VIII levels in venous thromboembolism.
18354102 2008 Polymorphisms associated with cholesterol and risk of cardiovascular events.
18336668 2008 Association analysis among polymorphisms of the various genes and chronic alcoholic pancreatitis.
18325076 2008 Genetic profile of ischemic cerebrovascular disease and carotid stenosis.
18321693 2008 Postprandial chylomicrons and adipose tissue lipoprotein lipase are altered in type 2 diabetes independently of obesity and whole-body insulin resistance.
18275964 2008 Low-density lipoprotein and high-density lipoprotein cholesterol levels in relation to genetic polymorphisms and menopausal status: the Atherosclerosis Risk in Communities (ARIC) Study.
18275685 2008 Familial lipoprotein lipase deficiency caused by known (G188E) and novel (W394X) LPL gene mutations.
18242618 2008 Functional significance of lipoprotein lipase HindIII polymorphism associated with the risk of coronary artery disease.
18223635 2008 Higher post-absorptive skeletal muscle LPL activity in African American vs. non-Hispanic White pre-menopausal women.
18193046 2008 Genome-wide scan identifies variation in MLXIPL associated with plasma triglycerides.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
18187430 2007 The lipoprotein lipase serine 447 stop polymorphism is associated with altered serum carotenoid concentrations in the Stanislas Family Study.
18175800 2008 Increased thermoregulation in cold-exposed transgenic mice overexpressing lipoprotein lipase in skeletal muscle: an avian phenotype?
18068174 2008 Genetic screening of the LPL gene in hypertriglyceridaemic patients.
18020971 2008 Genetic profiling in healthy subjects from the Stanislas cohort based on 24 polymorphisms: effects on biological variables.
17997385 2007 Normal binding of lipoprotein lipase, chylomicrons, and apo-AV to GPIHBP1 containing a G56R amino acid substitution.
17939375 2007 [Analysis on the association between two polymorphism haplotypes of lipoprotein lipase gene and serum lipids in twins of China].
17919884 2007 Prediction of genetic risk for dyslipidemia.
17903299 2007 A genome-wide association study for blood lipid phenotypes in the Framingham Heart Study.
17855807 2007 Maternal and fetal variation in genes of cholesterol metabolism is associated with preterm delivery.
17848837 Apolipoprotein E and lipoprotein lipase gene polymorphisms interaction on the atherogenic combined expression of hypertriglyceridemia and hyperapobetalipoproteinemia phenotypes.
17803213 2008 Lipoprotein lipase: A bioinformatics criterion for assessment of mutations as a risk factor for cardiovascular disease.
17761930 2007 Retention of low-density lipoprotein in atherosclerotic lesions of the mouse: evidence for a role of lipoprotein lipase.
17727701 2007 The D9N, N291S and S447X variants in the lipoprotein lipase (LPL) gene are not associated with Type III hyperlipidemia.
17726453 2008 Allelic variation in ApoC3, ApoA5 and LPL genes and first and second generation antipsychotic effects on serum lipids in patients with schizophrenia.
17721767 2007 Lipoprotein lipase HindIII polymorphism influences HDL-cholesterol levels in statin-treated patients with coronary artery disease.
17717288 2007 Resequencing genomic DNA of patients with severe hypertriglyceridemia (MIM 144650).
17706445 2007 A novel complex deletion-insertion mutation mediated by Alu repetitive elements leads to lipoprotein lipase deficiency.
17705673 2008 Lipoprotein lipase activity determined in vivo is lower in carriers of apolipoprotein A-V gene variants 19W and -1131C.
17700364 2007 Contribution of 20 single nucleotide polymorphisms of 13 genes to dyslipidemia associated with antiretroviral therapy.
17681919 2007 [Association of Hind RFLP in lipoprotein lipase gene with type 2 diabetes].
17662793 2007 Presence of lipoprotein lipase S447X stop codon affects the magnitude of interleukin 8 release after cardiac surgery with cardiopulmonary bypass.
17653444 2007 Lipoprotein lipase PvuII polymorphism is associated with variations in serum lipid levels in non-diabetic pregnant women.
17652898 2007 Decreased lipoprotein lipase in obstructive sleep apnea syndrome.
17644777 2007 Atorvastatin decreases lipoprotein lipase and endothelial lipase expression in human THP-1 macrophages.
17620184 Lipoprotein lipase activity and gene expression in lung cancer and in adjacent noncancer lung tissue.
17615573 2007 Analysis of multiple SNPs in genetic association studies: comparison of three multi-locus methods to prioritize and select SNPs.
17587400 2007 Dydrogesterone and norethisterone regulate expression of lipoprotein lipase and hormone-sensitive lipase in human subcutaneous abdominal adipocytes.
17568951 2007 Interaction effects of high-density lipoprotein metabolism gene variation and alcohol consumption on coronary heart disease risk: the atherosclerosis risk in communities study.
17562973 2007 Angiotensin-converting enzyme genotype interacts with systolic blood pressure to determine coronary heart disease risk in healthy middle-aged men.
17560523 2007 Genetic screening of the lipoprotein lipase gene for mutations in Chinese subjects with or without hypertriglyceridemia.
17555736 2007 The S447X variant of lipoprotein lipase gene is associated with metabolic syndrome and lipid levels among Turks.
17535427 2007 Dynamics of adipogenic promoter DNA methylation during clonal culture of human adipose stem cells to senescence.
17533471 2007 The S447X polymorphism of lipoprotein lipase: effect on the incidence of premature coronary disease and on plasma lipids.
17517063 2007 Lipoprotein lipase mediates hepatitis C virus (HCV) cell entry and inhibits HCV infection.
17487735 2007 Expression level of lipoprotein lipase and dystrophin genes predict survival in B-cell chronic lymphocytic leukemia.
17484619 2007 Association of lipase lipoprotein polymorphisms with myocardial infarction and lipid levels.
17476032 2007 Novel mutations of the lipoprotein lipase gene associated with hypertriglyceridemia in members of type 2 diabetic pedigrees.
17473385 2007 Lipoprotein lipase gene PvuII polymorphism serum lipids and risk for coronary artery disease: meta-analysis.
17463246 2007 Genome-wide association analysis identifies loci for type 2 diabetes and triglyceride levels.
17436307 2007 An application of the patient rule-induction method for evaluating the contribution of the Apolipoprotein E and Lipoprotein Lipase genes to predicting ischemic heart disease.
17428620 2007 Body mass, polymorphisms in obesity-related genes, and the risk of developing breast cancer among women with benign breast disease.
17374417 2007 Effect of metformin on serum lipoprotein lipase mass levels and LDL particle size in type 2 diabetes mellitus patients.
17356047 2007 Dysregulation of placental endothelial lipase and lipoprotein lipase in intrauterine growth-restricted pregnancies.
17347923 2008 Expression of lipoprotein lipase associated with lung adenocarcinoma tissues.
17342071 2007 Genetic epistasis in the VLDL catabolic pathway is associated with deleterious variations on triglyceridemia in obese subjects.
17328917 2007 Polymorphism of apolipoprotein E (APOE) and lipoprotein lipase (LPL) genes and ischaemic stroke in individuals of Yakut ethnicity.
17318300 2007 The combination of ApoCIII, hepatic lipase and hormono sensitive lipase gene polymorphisms suggests an association with susceptibility to gestational hypertension.
17311894 2007 Sex differences in abdominal, gluteal, and thigh LPL activity.
17299379 2007 Association of lipoprotein lipase gene polymorphisms with obesity and type 2 diabetes in an Asian Indian population.
17299085 2007 Effect of maternal triglycerides and free fatty acids on placental LPL in cultured primary trophoblast cells and in a case of maternal LPL deficiency.
17291198 2007 The lipoprotein lipase gene serine 447 stop variant influences hypertension-induced left ventricular hypertrophy and risk of coronary heart disease.
17244606 2007 Activation of lipoprotein lipase by glucose-dependent insulinotropic polypeptide in adipocytes. A role for a protein kinase B, LKB1, and AMP-activated protein kinase cascade.
17163816 2006 Lipoprotein lipase gene polymorphism at the PvuII locus and serum lipid levels in Guangxi Hei Yi Zhuang and Han populations.
17157861 2007 Associations between HDL-cholesterol and polymorphisms in hepatic lipase and lipoprotein lipase genes are modified by dietary fat intake in African American and White adults.
17137217 2006 Association of sixty-one non-synonymous polymorphisms in forty-one hypertension candidate genes with blood pressure variation and hypertension.
17130180 2007 Candidate gene genotypes, along with conventional risk factor assessment, improve estimation of coronary heart disease risk in healthy UK men.
17093291 2007 Suppression of endothelial or lipoprotein lipase in THP-1 macrophages attenuates proinflammatory cytokine secretion.
17072956 2006 Impact of lipoprotein lipase gene polymorphisms on ulcerative colitis.
17058522 2006 Association of two genetic variations of lipoprotein lipase, S447X and Hind III, with coronary artery disease and hypertriglyceridemia.
17032721 2007 Haplotypes in the lipoprotein lipase gene influence fasting insulin and discovery of a new risk haplotype.
17029199 2006 [Associations between Ser447Ter gene polymorphism of lipoprotein lipase and atherosclerotic cerebral infarction].
17018885 2007 Reduction of plasma triglycerides in apolipoprotein C-II transgenic mice overexpressing lipoprotein lipase in muscle.
17006673 2007 Subsets of SNPs define rare genotype classes that predict ischemic heart disease.
17001213 2006 Relationship of classical and non-classical risk factors with genetic variants relevant to coronary heart disease.
16989840 2007 Enhanced apoB48 metabolism in lipoprotein lipase X447 homozygotes.
16965549 2006 A polymorphism in lipoprotein lipase affects the severity of Alzheimer's disease pathophysiology.
16928730 2006 Identifying genetic susceptibilities to diabetes-related complications among individuals at low risk of complications: An application of tree-structured survival analysis.
16926441 2006 Gestational and hormonal regulation of human placental lipoprotein lipase.
16896939 2006 Insulin sensitisation affects lipoprotein lipase transport in type 2 diabetes: role of adipose tissue and skeletal muscle in response to rosiglitazone.
16894468 2006 Assessment of genetic risk for myocardial infarction.
16864937 2006 Effect of SstI polymorphism of the apolipoprotein CIII gene and environmental factors on risks of hypertriglyceridemia in Taiwan aborigines.
16840197 2006 Lipoprotein lipase expression is a novel prognostic factor in B-cell chronic lymphocytic leukemia.
16837242 2006 Association of lipoprotein receptor, receptor-associated protein, and metabolizing enzyme gene polymorphisms with gallstone disease: A case-control study.
16829344 2006 Variation in the cholesteryl ester transfer protein (CETP) gene does not influence individual plasma cholesterol response to changes in the nature of dietary fat.
16822320 2006 The lipoprotein lipase gene in combined hyperlipidemia: evidence of a protective allele depletion.
16813599 2006 Association of lipoprotein lipase S447X, apolipoprotein E exon 4, and apoC3 -455T>C polymorphisms on the susceptibility to diabetic nephropathy.
16799404 2006 . Association of HindIII and PvuII genetic polymorphisms of lipoprotein lipase with lipid metabolism and macrovascular events in type 2 diabetic patients.
16776623 2006 Polymorphisms associated with apolipoprotein B levels in Greek patients with familial hypercholesterolemia.
16770077 2006 Concordant association of lipid gene variation with a combined HDL/LDL-cholesterol phenotype in two European populations.
16763159 2006 Consistent effects of genes involved in reverse cholesterol transport on plasma lipid and apolipoprotein levels in CARDIA participants.
16755277 2007 Haplotypes in the lipoprotein lipase gene influence high-density lipoprotein cholesterol response to statin therapy and progression of atherosclerosis in coronary artery bypass grafts.
16741292 2006 A systematic review and meta-analysis of the relationship between lipoprotein lipase Asn291Ser variant and diseases.
16702309 2006 Plasma triglyceride and HDL-cholesterol concentrations in Vietnamese girls are affected by lipoprotein lipase, but not apolipoprotein CIII polymorphism.
16651467 2006 Polymorphism in the beta2-adrenergic receptor and lipoprotein lipase genes as risk determinants for idiopathic venous thromboembolism: a multilocus, population-based, prospective genetic analysis.
16635607 2006 Association of lipoprotein lipase Hind III and Ser 447 Ter polymorphisms with dyslipidemia in Asian Indians.
16630553 2006 Gene polymorphisms in the Quebec population: a risk to develop hypertriglyceridemia.
16552397 2006 Lipoprotein lipase gene S447X polymorphism modulates the relation between central obesity and serum lipids, a twin study.
16544732 2006 Candidate gene polymorphism in cardiovascular disease: the BIP cohort.
16542392 2006 Common variants of multiple genes that control reverse cholesterol transport together explain only a minor part of the variation of HDL cholesterol levels.
16534528 2006 Influence of lipoprotein lipase gene Ser447Stop and beta1-adrenergic receptor gene Arg389Gly polymorphisms and their interaction on obesity from childhood to adulthood: the Bogalusa Heart Study.
16519597 2006 Associations of apolipoprotein E exon 4 and lipoprotein lipase S447X polymorphisms with acute ischemic stroke and myocardial infarction.
16517593 2006 Interaction of lipoprotein lipase and receptor-associated protein.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16466345 2006 Mitochondria maintain maturation and secretion of lipoprotein lipase in the endoplasmic reticulum.
16460718 2006 A novel nonsense mutation in the LPL gene in a Chinese neonate with hypertriglyceridemia.
16451134 2006 Functional variants of the lipoprotein lipase gene and the risk of preeclampsia among non-Hispanic Caucasian women.
16449872 2006 Hepatic lipase C-514T polymorphism and its association with high-density lipoprotein cholesterol level in Tehran.
16446009 2006 Enhancement of serum lipoprotein lipase mass levels by intensive insulin therapy.
16431216 2006 A novel substitution at the translation initiator codon (ATG-->ATC) of the lipoprotein lipase gene is mainly responsible for lipoprotein lipase deficiency in a patient with severe hypertriglyceridemia and recurrent pancreatitis.
16430904 2006 Association between well-characterized lipoprotein-related genetic variants and carotid intimal medial thickness and stenosis: The Framingham Heart Study.
16419488 2005 Role of candidate genes in the lipid responses to intensified treatment in Type 2 diabetes.
16418216 2006 Combined analysis of six lipoprotein lipase genetic variants on triglycerides, high-density lipoprotein, and ischemic heart disease: cross-sectional, prospective, and case-control studies from the Copenhagen City Heart Study.
16416313 2006 Variation in the lipoprotein lipase gene influences exercise-induced left ventricular growth.
16378107 2005 [Association and linkage analysis between the S447X polymorphism of LPL gene and serum lipids, blood pressures in twins].
16369102 2006 Genetic and environmental factors associated with the development of hypertension in pregnancy.
16364275 2006 Relationship between plasma HDL subclasses distribution and lipoprotein lipase gene HindIII polymorphism in hyperlipidemia.
16357806 2005 Correlation between the activities of lipoprotein lipase and paraoxonase in type 2 diabetes mellitus.
16353345 1993 Tissue-specific lipoprotein lipase: relationships to body composition and body fat distribution in normal weight humans.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16343038 2006 Effect of gene polymorphisms on lipoprotein levels in patients with dyslipidemia of metabolic syndrome.
16256241 2006 Glucose-stimulated insulin response in non-diabetic patients with lipoprotein lipase deficiency and hypertriglyceridemia.
16253639 2005 Carriers of the frequent lipoprotein lipase S447X variant exhibit enhanced postprandial apoprotein B-48 clearance.
16205020 2005 Polymorphisms in four genes related to triglyceride and HDL-cholesterol levels in the general Japanese population in 2000.
16195478 2005 Enhanced conversion of triglyceride-rich lipoproteins and increased low-density lipoprotein removal in LPLS447X carriers.
16179346 2005 Calcium triggers folding of lipoprotein lipase into active dimers.
16168296 2005 Lipoprotein lipase gene polymorphisms and the risk of target vessel revascularization after percutaneous coronary intervention.
16142021 2005 Combination of apolipoprotein E2 and lipoprotein lipase heterozygosity causes severe hypertriglyceridemia during pregnancy.
16141008 2005 Association of genes of lipid metabolism with measures of subclinical cardiovascular disease in the Diabetes Heart Study.
16135440 2002 [Variants of exon 4 and its flanking region of LPL Gene in patients with hyperlipidemia].
16132104 2005 Lipoprotein lipase gene is linked and associated with hypertension in Taiwan young-onset hypertension genetic study.
16122151 2005 Post-heparin plasma lipoprotein lipase, but not hepatic lipase activity, is related to plasma adiponectin in type 2 diabetic patients and healthy subjects.
16106048 2005 Lipoprotein metabolism of pregnant women is associated with both their genetic polymorphisms and those of their newborn children.
16086925 2005 Candidate gene susceptibility variants predict intermediate end points but not angiographic coronary artery disease.
16030523 2005 Genetic determinants of plasma HDL-cholesterol levels in familial hypercholesterolemia.
16029634 2005 [The effect of lipoprotein lipase (LPL) polymorphism on plasma LPL concentration and triglyceride].
16015281 2005 Effect of the APOC3 Sst I SNP on fasting triglyceride levels in men heterozygous for the LPL P207L deficiency.
16013913 2005 A cluster of cholesterol-related genes confers susceptibility for Alzheimer's disease.
15994321 2005 Differential effects of lipoprotein lipase on tumor necrosis factor-alpha and interferon-gamma-mediated gene expression in human endothelial cells.
15979432 2005 Family-based association studies of lipid gene polymorphisms in coronary artery disease.
15961789 2005 Higher order lipase gene association with plasma triglycerides.
15939061 2005 Low density lipoprotein non-esterified fatty acids and lipoprotein lipase in diabetes.
15928243 2005 The 3' untranslated region of the lipoprotein lipase gene: haplotype structure and association with post-heparin plasma lipase activity.
15896905 2005 Cholesteryl ester transfer protein TaqI B and lipoprotein lipase Ser447Ter gene polymorphisms are not associated with ischaemic stroke in Greek patients.
15878772 2005 The recovery of dysfunctional lipoprotein lipase (Asp204-Glu) activity by modification of substrate.
15877202 2005 Hyperchylomicronaemia due to lipoprotein lipase deficiency as a cause of false-positive newborn screening for biotinidase deficiency.
15858619 2005 High expression of lipoprotein lipase in poor risk B-cell chronic lymphocytic leukemia.
15857159 2006 Relationship among urinary albumin excretion rate, lipoprotein lipase PvuII polymorphism and plasma fibrinogen in type 2 diabetic patients.
15802535 2005 The LPL/ADAM29 expression ratio is a novel prognosis indicator in chronic lymphocytic leukemia.
15795426 2005 The lowering of plasma lipids following a weight reduction program is related to increased expression of the LDL receptor and lipoprotein lipase.
15793775 2005 [The association of S447X and Hind III polymorphism in the lipoprotein lipase gene with dyslipidemia of the metabolic syndrome in patients with essential hypertension].
15764642 2005 Additive effects of the PPARgamma, APOE, and FABP-2 genes in increasing daylong triglycerides of normolipidemic women to concentrations comparable to those in men.
15749185 2005 A study of lipoprotein lipase gene intron 8 polymorphisms in Chinese Han race essential hypertension patients.
15721013 2005 Macrophage-derived lipoprotein lipase increases aortic atherosclerosis in cholesterol-fed Tg rabbits.
15699916 2004 [Genetic Predictors of Unfavorable Course in High Risk Patients With Ischemic Heart Disease. Data of Follow-up for Two Years.].
15696473 2005 [Single nucleotide polymorphisms of genes associated with high density lipoprotein metabolism in Chinese population].
15657615 2005 Polymorphisms in APOA1 and LPL genes are statistically independently associated with fasting TG in men with CAD.
15637076 2005 Pancreatic beta-cell lipoprotein lipase independently regulates islet glucose metabolism and normal insulin secretion.
15608561 2004 Response to micronized fenofibrate treatment is associated with the peroxisome-proliferator-activated receptors alpha G/C intron7 polymorphism in subjects with type 2 diabetes.
15562208 2004 Decreased plasma lipoprotein lipase in hypoadiponectinemia: an association independent of systemic inflammation and insulin resistance.
15545743 Lipoprotein lipase locus and progression of atherosclerosis in coronary-artery bypass grafts.
15543643 DNA polymorphism of Pvu II site in the lipoprotein lipase gene in patients with non-insulin dependent diabetes mellitus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386377 2004 Association of lipoprotein lipase gene polymorphism with risk of prostate cancer in a Japanese population.
15356086 2004 The influence of lipoprotein lipase gene variation on postprandial lipoprotein metabolism.
15331147 2004 The H+ allele of the lipoprotein lipase (LPL) HindIII intronic polymorphism and the risk for sporadic late-onset Alzheimer's disease.
15292372 2004 Genetic variants of the lipoprotein lipase gene and myocardial infarction in the Central Valley of Costa Rica.
15292370 2004 Polymorphisms in the gene encoding lipoprotein lipase in men with low HDL-C and coronary heart disease: the Veterans Affairs HDL Intervention Trial.
15270617 2004 Lipoprotein lipase gene polymorphism and lipid profile in coronary artery disease.
15257172 2004 The S447X polymorphism of the lipoprotein lipase gene is associated with lipoprotein lipid and blood pressure levels in Chinese patients with essential hypertension.
15256764 2004 Mutations in Japanese subjects with primary hyperlipidemia--results from the Research Committee of the Ministry of Health and Welfare of Japan since 1996--.
15256516 2004 Lipid-related genes and myocardial infarction in 4685 cases and 3460 controls: discrepancies between genotype, blood lipid concentrations, and coronary disease risk.
15253101 2004 Lipoprotein lipase gene polymorphisms and blood pressure levels in the Northern Chinese Han population.
15221136 2004 Overexpression of lipoprotein lipase improves insulin resistance induced by a high-fat diet in transgenic rabbits.
15202783 2004 Analysis of candidate genes in Polish families with obesity.
15189363 2004 Lipoprotein lipase gene variants and progression of nephropathy in hypercholesterolaemic patients with type 2 diabetes.
15185149 2004 Severe hypertriglyceridaemia in a Greek infant: a clinical, biochemical and genetic study.
15178420 2004 Mechanism of triglyceride lowering in mice expressing human apolipoprotein A5.
15155715 2004 Lipid-binding proteins and lipoprotein lipase activity in human skeletal muscle: influence of physical activity and gender.
15135251 2004 Genetic polymorphisms affecting the phenotypic expression of familial hypercholesterolemia.
15127290 2004 Lipoprotein lipase gene is in linkage with blood pressure phenotypes in Chinese pedigrees.
15115692 2004 Missense mutation W86R in exon 3 of the lipoprotein lipase gene in a boy with chylomicronemia.
15076187 2004 Genetic influences on blood pressure within the Stanislas Cohort.
15060087 2004 The lipoprotein lipase S447X polymorphism and plasma lipids: interactions with APOE polymorphisms, smoking, and alcohol consumption.
15051515 2004 Lipoprotein lipase protects bovine endothelial cells from human NK cytotoxic activity.
15019539 2004 Lipoprotein concentrations in newborns are associated with allelic variations in their mothers.
14988305 2004 The relationship of lipoprotein lipase activity and LDL size is dependent on glucose metabolism in an elderly population: the Hoorn Study.
14988233 2004 Systemic and forearm triglyceride metabolism: fate of lipoprotein lipase-generated glycerol and free fatty acids.
14984478 2004 Identification of the first Lebanese mutation in the LPL gene and description of a rapid detection method.
14984315 2004 Hyperglycemia downregulates total lipoprotein lipase activity in humans.
14967813 2004 Alteration in lipoprotein lipase activity bound to triglyceride-rich lipoproteins in the postprandial state in type 2 diabetes.
14764824 2004 Enhanced lipoprotein lipase secretion and foam cell formation by macrophages of patients with growth hormone deficiency: possible contribution to increased risk of atherogenesis?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14693718 2004 Lipoprotein lipase is a gene for insulin resistance in Mexican Americans.
14669227 2003 [Study on lipoprotein lipase gene Hind III polymorphism in Chinese type IIb hyperlipoproteinemia].
14660566 2004 Overexpression of lipoprotein lipase in transgenic Watanabe heritable hyperlipidemic rabbits improves hyperlipidemia and obesity.
14581156 2003 Gender differences in the effect of type 2 diabetes on serum lipids, pre-heparin plasma lipoprotein lipase mass and other metabolic parameters in Japanese population.
14580165 2003 Common variants in the lipoprotein lipase gene in Brazil: association with lipids and angiographically assessed coronary atherosclerosis.
14580156 2003 A common truncated variant of lipoprotein lipase in the Japanese population is characterized by pattern B phenotype.
14570890 2004 Mice expressing only covalent dimeric heparin binding-deficient lipoprotein lipase: muscles inefficiently secrete dimeric enzyme.
14564687 2003 Interaction effect of Serine447Stop variant of the lipoprotein lipase gene and C-514T variant of the hepatic lipase gene on serum triglyceride levels in young adults: the Bogalusa Heart Study.
14553962 2003 Effects of endothelial nitric oxide synthase, alpha-adducin, and other candidate gene polymorphisms on blood pressure response to hydrochlorothiazide.
12966036 2003 Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors.
12964943 2003 Genetic study of common variants at the Apo E, Apo AI, Apo CIII, Apo B, lipoprotein lipase (LPL) and hepatic lipase (LIPC) genes and coronary artery disease (CAD): variation in LIPC gene associates with clinical outcomes in patients with established CAD.
12919138 2003 Cholesterol ester transfer protein, apolipoprotein E and lipoprotein lipase genotypes in patients with coronary artery disease in the Turkish population.
12915220 2003 Postprandial triglyceride levels in familial combined hyperlipidemia. The role of apolipoprotein E and lipoprotein lipase polymorphisms.
12905705 2003 [Mutation-function analysis in the lipoprotein lipase gene of Chinese patients with hypertriglyceridemic type 2 diabetes].
12889841 2003 Effect of six candidate genes on early aging in a French population.
12876415 2003 Lipoprotein lipase activity and common gene variants in severely hypertriglyceridemic patients with and without diabetes.
12866915 2003 Genetics of the lipoprotein lipase gene and hypertriglyceridaemia.
12865761 Determination and use of haplotypes: ethnic comparison and association of the lipoprotein lipase gene and coronary artery disease in Mexican-Americans.
12862202 2003 Variation near the region of the lipoprotein lipase gene and hypertension or blood pressure levels in Chinese.
12818414 2003 Influence of common variants in the CETP, LPL, HL and APO E genes on LDL heterogeneity in healthy, middle-aged men.
12793009 2003 [Relations of lipoprotein lipase gene polymorphism at Pvu II locus and dietary intervention predisposition in hyperlipidemia population].
12782148 2003 Effects of plasma apolipoproteins on lipoprotein lipase-mediated lipolysis of small and large lipid emulsions.
12777470 2003 Lipoprotein lipase and hepatic lipase: their relationship with HDL subspecies Lp(A-I) and Lp(A-I,A-II).
12747600 2003 Lipoprotein lipase gene polymorphisms in Croatian patients with coronary artery disease.
12746411 2003 Evidence for linkage and association of the markers near the LPL gene with hypertension in Chinese families.
12740382 2003 Calreticulin promotes folding/dimerization of human lipoprotein lipase expressed in insect cells (sf21).
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12708905 2003 Lack of association of lipoprotein lipase gene polymorphisms with coronary artery disease in the Saudi Arab population.
12704407 2003 Effect of obesity on HDL and LDL particle sizes in carriers of the null P207L or defective D9N mutation in the lipoprotein lipase gene: the Québec LipD Study.
12701046 2003 17Beta-estradiol and anti-estrogen ICI:compound 182,780 regulate expression of lipoprotein lipase and hormone-sensitive lipase in isolated subcutaneous abdominal adipocytes.
12690214 2003 Lipoprotein lipase (LPL) gene variation and progression of carotid artery plaque.
12687649 2003 Association between lipoprotein lipase (LPL) gene and blood lipids: a common variant for a common trait?
12679477 2003 Identification of functional prolactin (PRL) receptor gene expression: PRL inhibits lipoprotein lipase activity in human white adipose tissue.
12655575 2003 Pathogenic mutations of the lipoprotein lipase gene in Chinese patients with hypertriglyceridemic type 2 diabetes.
12647273 2003 The lipoprotein lipase gene HindIII polymorphism is associated with lipid levels in early-onset type 2 diabetic patients.
12641539 2003 Novel LPL mutation (L303F) found in a patient associated with coronary artery disease and severe systemic atherosclerosis.
12636935 2003 The lipoprotein lipase Ser447Ter mutation and risk of stroke in the Chinese.
12573449 2003 VLDL-induced triglyceride accumulation in human macrophages is mediated by modulation of LPL lipolytic activity in the absence of change in LPL mass.
12544508 2003 A microarray minisequencing system for pharmacogenetic profiling of antihypertensive drug response.
12514935 2002 Loci for CETP, LPL, LIPC, and APOC3 affect plasma lipoprotein size and sub-population distribution in Hispanic and non-Hispanic white subjects: the Columbia University BioMarkers Study.
12501246 2003 Lipoprotein lipase affects the survival and differentiation of neural cells exposed to very low density lipoprotein.
12483461 2002 Lipoprotein lipase: structure, function, regulation, and role in disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446192 2002 Analysis of several hundred genetic polymorphisms may improve assessment of the individual genetic burden for coronary artery disease.
12408999 2002 Single-nucleotide polymorphisms in the lipoprotein lipase gene associated with coronary heart disease in Chinese.
12370850 2002 Common variants in the lipoprotein lipase gene, but not those in the insulin receptor substrate-1, the beta3-adrenergic receptor, and the intestinal fatty acid binding protein-2 genes, influence the lipid phenotypic expression in familial combined hyperlipidemia.
12230584 2002 Molecular modeling of the dimeric structure of human lipoprotein lipase and functional studies of the carboxyl-terminal domain.
12226739 2002 Endothelial-derived lipoprotein lipase is bound to postprandial triglyceride-rich lipoproteins and mediates their hepatic clearance in vivo.
12208477 2002 Effect of gender on phenotypic expression of the S447X mutation in LPL: the Copenhagen City Heart Study.
12204001 2002 Genotype-phenotype studies of six novel LPL mutations in Chinese patients with hypertriglyceridemia.
12174215 2002 Genetic and environmental determinants of plasma high density lipoprotein cholesterol and apolipoprotein AI concentrations in healthy middle-aged men.
12164879 2002 Nephropathy in type 1 diabetes: a manifestation of insulin resistance and multiple genetic susceptibilities? Further evidence from the Pittsburgh Epidemiology of Diabetes Complication Study.
12133567 2002 Lack of association of two lipoprotein lipase polymorphisms with Alzheimer's disease.
12133533 2002 Relationship between a novel polymorphism of lipoprotein lipase gene and coronary heart disease.
12117735 2002 Characterization of LDL particle size among carriers of a defective or a null mutation in the lipoprotein lipase gene: the Québec LIPD Study.
12107736 2002 Lipoprotein lipase gene variants relate to presence and degree of microalbuminuria in Type II diabetes.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12044583 2002 Coronary artery disease and dyslipidemia within Europe: genetic variants in lipid transport gene loci in German subjects with premature coronary artery disease.
12042669 2002 Effect of apolipoprotein E, peroxisome proliferator-activated receptor alpha and lipoprotein lipase gene mutations on the ability of fenofibrate to improve lipid profiles and reach clinical guideline targets among hypertriglyceridemic patients.
11996946 2002 Determinants of HDL particle size in patients with the null (P207L) or defective (D9N) mutation in the lipoprotein lipase gene: the Québec LipD Study.
11921083 2002 LPL polymorphism predicts stroke risk in men.
11899831 2002 [HindIII DNA-polymorphism of lipoprotein lipase gene in elderly patients with ischemic heart disease].
11897170 2002 No association between the lipoprotein lipase S447X polymorphism and Alzheimer's disease.
11893778 2002 Associations of LPL and APOC3 gene polymorphisms on plasma lipids in a Mediterranean population: interaction with tobacco smoking and the APOE locus.
11893776 2002 Structural and functional consequences of missense mutations in exon 5 of the lipoprotein lipase gene.
11852057 2002 Peroxisome proliferator-activated receptor (PPAR) agonists decrease lipoprotein lipase secretion and glycated LDL uptake by human macrophages.
11834518 2002 Lipoprotein lipase in the arterial wall: linking LDL to the arterial extracellular matrix and much more.
11796707 2002 A novel role of Sp1 and Sp3 in the interferon-gamma -mediated suppression of macrophage lipoprotein lipase gene transcription.
11730816 2001 Influence of lipoprotein lipase serine 447 stop polymorphism on tracking of triglycerides and HDL cholesterol from childhood to adulthood and familial risk of coronary artery disease: the Bogalusa heart study.
11714860 2001 Lipoprotein lipase and apoE polymorphisms: relationship to hypertriglyceridemia during pregnancy.
11714857 2001 Genetic influences on lipid metabolism trait variability within the Stanislas Cohort.
11711487 2001 Lipoprotein lipase gene mutations and the genetic susceptibility of preeclampsia.
11702219 2001 Physical activity modulates the combined effect of a common variant of the lipoprotein lipase gene and smoking on serum triglyceride levels and high-density lipoprotein cholesterol in men.
11702052 2001 Potential genetic markers of sporadic Alzheimer's dementia.
11683775 2001 The LPL S447X cSNP is associated with decreased blood pressure and plasma triglycerides, and reduced risk of coronary artery disease.
11680797 2001 Association of lipoprotein lipase Ser447Ter polymorphism with brain infarction: a population-based neuropathological study.
11605530 [Connection of HindIII-polymorphism in the lipoprotein lipase gene with myocardial infarct and life span in elderly ischemic heart disease patients].
11593500 2001 Lipoprotein lipase gene polymorphism and lipid profile in patients with hypertriglyceridemia.
11579204 2001 Farnesoid X-activated receptor induces apolipoprotein C-II transcription: a molecular mechanism linking plasma triglyceride levels to bile acids.
11534394 2001 [HindIII polymorphism of lipoprotein lipase gene and risk of myocardial infarction].
11533368 2001 Age-related effects of genetic variation on lipid levels: The Columbia University BioMarkers Study.
11500192 2001 Genetic variation at the lipoprotein lipase locus and plasma lipoprotein and insulin levels in the Québec Family Study.
11484171 2001 [Studies on association between lipoprotein lipase gene polymorphisms of Pvu II site and hypertriglyceridemics in Chinese].
11441189 2001 Polymorphism of the lipoprotein lipase gene and risk of atherothrombotic cerebral infarction in the Japanese.
11441134 2001 Novel compound heterozygous mutations for lipoprotein lipase deficiency. A G-to-T transversion at the first position of exon 5 causing G154V missense mutation and a 5' splice site mutation of intron 8.
11427211 2001 Lipoprotein lipase D9N, N291S and S447X polymorphisms: their influence on premature coronary heart disease and plasma lipids.
11395037 2001 Common mutations in the lipoprotein lipase gene (LPL): effects on HDL-cholesterol levels in a Chinese Canadian population.
11342582 2001 Heparin-binding defective lipoprotein lipase is unstable and causes abnormalities in lipid delivery to tissues.
11341749 2001 Candidate gene polymorphisms in cardiovascular disease: a comparative study of frequencies between a French and an Italian population.
11316129 2001 Potentially protective effects of the Ser447-Ter mutation of the lipoprotein lipase gene against the development of coronary artery disease in Japanese subjects via a beneficial lipid profile.
11284423 2001 [Polymorphisms in genes for cholesterol ester transfer protein, apolipoprotein C-III and lipoprotein lipase in children with high and low cholesterol levels] ].
11229437 2001 Interactions among the glucocorticoid receptor, lipoprotein lipase, and adrenergic receptor genes and plasma insulin and lipid levels in the Quebec Family Study.
11205691 2000 Hypertriglyceridemia characterized by low-density lipoprotein phenotype and lipoprotein lipase gene mutation.
11194013 2000 Polymorphism of the gene encoding lipoprotein lipase in thai primary hyperlipoproteinemias.
11171287 2001 Common genetic variants that relate to disorders of lipid transport in Spanish subjects with premature coronary artery disease.
11140837 2000 The common mutations in the lipoprotein lipase gene in Italy: effects on plasma lipids and angiographically assessed coronary atherosclerosis.
11134145 2000 Type I hyperlipoproteinemia due to a novel loss of function mutation of lipoprotein lipase, Cys(239)-->Trp, associated with recurrent severe pancreatitis.
11132601 2000 Lipoprotein lipase (C/G)447 polymorphism and blood pressure in the Stanislas Cohort.
11126401 2000 Severe hypertriglyceridaemia in Type II diabetes: involvement of apoC-III Sst-I polymorphism, LPL mutations and apo E3 deficiency.
11099402 2000 A compound heterozygote for a novel missense mutation (G105R) in exon 3 and a missense mutation (D204E) in exon 5 of the lipoprotein lipase gene in a Japanese infant with hyperchylomicronaemia.
11096142 2000 Lack of relationship in long-term type 1 diabetic patients between diabetic nephropathy and polymorphisms in apolipoprotein epsilon, lipoprotein lipase and cholesteryl ester transfer protein. Genétique de la Nephropathie Diabétique Study Group. Données Epidémiologiques sur le Syndrome d'Insulino-Résistance Study Group.
11073182 2000 Interaction between the Asn291Ser variant of the LPL gene and insulin resistance on dyslipidaemia in high risk individuals for Type 2 diabetes mellitus.
11068186 2000 A newly identified lipoprotein lipase (LPL) gene mutation (F270L) in a Japanese patient with familial LPL deficiency.
10787434 2000 Two novel mutations in the lipoprotein lipase gene in a family with marked hypertriglyceridemia in heterozygous carriers. Potential interaction with the polymorphic marker D1S104 on chromosome 1q21-q23.
10727238 2000 Apolipoprotein C-II39-62 activates lipoprotein lipase by direct lipid-independent binding.
10660334 1998 Compound heterozygosity for a new (S259G) and a previously described (G188E) mutation in lipoprotein lipase (LpL) as a cause of chylomicronemia. Mutations in brief no. 183. Online.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
10085125 1999 Sortilin/neurotensin receptor-3 binds and mediates degradation of lipoprotein lipase.
9719626 1998 Common genetic variants of lipoprotein lipase and apolipoproteins AI-CIII that relate to coronary artery disease: a study in Chinese and European subjects.
9714430 1998 Ile225Thr loop mutation in the lipoprotein lipase (LPL) gene is a de novo event.
9662394 1998 DNA sequence diversity in a 9.7-kb region of the human lipoprotein lipase gene.
9519338 1998 Lipoprotein metabolism.
9498099 1998 A novel Glu421Lys substitution in the lipoprotein lipase gene in pregnancy-induced hypertriglyceridemic pancreatitis.
9430364 1997 Common variation in the lipoprotein lipase gene: effects on plasma lipids and risk of atherosclerosis.
9401010 1997 Familial lipoprotein lipase (LPL) deficiency: a catalogue of LPL gene mutations identified in 20 patients from the UK, Sweden, and Italy.
9374130 1997 Relationship between lipoprotein lipase and high density lipoprotein cholesterol in mice: modulation by cholesteryl ester transfer protein and dietary status.
9298816 1997 A single Ser259Arg mutation in the gene for lipoprotein lipase causes chylomicronemia in Moroccans of Berber ancestry.
9279761 1997 Assessment of French patients with LPL deficiency for French Canadian mutations.
9183545 1997 The tissue-specific expression of lipoprotein lipase: implications for energy and lipoprotein metabolism.
8956052 1996 A novel missense (E163G) mutation in the catalytic subunit of lipoprotein lipase causes familial chylomicronemia.
8956048 1996 Compound heterozygosity for a known (D250N) and a novel (E410K) missense mutation in the C-terminal domain of lipoprotein lipase causes familial chylomicronemia.
8872057 1996 Lipoprotein lipase gene mutations D9N and N291S in four pedigrees with familial combined hyperlipidaemia.
8858123 1996 A new mutation destroying disulphide bridging in the C-terminal domain of lipoprotein lipase.
8778602 1996 Premature atherosclerosis in patients with familial chylomicronemia caused by mutations in the lipoprotein lipase gene.
8728326 1996 Homozygosity for two point mutations in the lipoprotein lipase (LPL) gene in a patient with familial LPL deficiency: LPL(Asp9-->Asn, Tyr262-->His).
8567671 1996 The mutation Gly142-->Glu in human lipoprotein lipase produces a missorted protein that is diverted to lysosomes.
8486765 1993 Gene-environment interaction in the conversion of a mild-to-severe phenotype in a patient homozygous for a Ser172-->Cys mutation in the lipoprotein lipase gene.
8449037 1993 Assignment of the human lipoprotein lipase (LPL) gene to chromosome band 8p22.
8325986 1993 Mutations in exon 3 of the lipoprotein lipase gene segregating in a family with hypertriglyceridemia, pancreatitis, and non-insulin-dependent diabetes.
8308035 1994 Lipoprotein lipase. Molecular model based on the pancreatic lipase x-ray structure: consequences for heparin binding and catalysis.
8301230 1993 Recurrent pancreatitis and chylomicronemia in an extended Dutch kindred is caused by a Gly154-->Ser substitution in lipoprotein lipase.
8288243 1993 A novel missense mutation in the gene for lipoprotein lipase resulting in a highly conservative amino acid substitution (Asp180-->Glu) causes familial chylomicronemia (type I hyperlipoproteinemia).
8144523 1994 An amino-terminal fragment of apolipoprotein B binds to lipoprotein lipase and may facilitate its binding to endothelial cells.
8135797 1994 A new Italian case of lipoprotein lipase deficiency: a Leu365- > Val change resulting in loss of enzyme activity.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8096693 1993 A missense mutation (Ala334-->Thr) in exon 7 of the lipoprotein lipase gene in a case with type I hyperlipidemia.
8077845 1994 High frequency of mutations in the human lipoprotein lipase gene in pregnancy-induced chylomicronemia: possible association with apolipoprotein E2 isoform.
7999071 1994 A naturally occurring mutation at the second base of codon asparagine 43 in the proposed N-linked glycosylation site of human lipoprotein lipase: in vivo evidence that asparagine 43 is essential for catalysis and secretion.
7989348 1994 A carboxyl-terminal fragment of lipoprotein lipase binds to the low density lipoprotein receptor-related protein and inhibits lipase-mediated uptake of lipoprotein in cells.
7912254 1994 A compound heterozygote for lipoprotein lipase deficiency, Val69-->Leu and Gly188-->Glu: correlation between in vitro LPL activity and clinical expression.
7906986 1994 Recurrent missense mutations at the first and second base of codon Arg243 in human lipoprotein lipase in patients of different ancestries.
7818530 1995 Lipoprotein lipase: role of intramolecular disulfide bonds in enzyme catalysis.
7806969 1994 A novel missense mutation in the C-terminal domain of lipoprotein lipase (Glu410-->Val) leads to enzyme inactivation and familial chylomicronemia.
7753827 1995 A mutation in the promoter of the lipoprotein lipase (LPL) gene in a patient with familial combined hyperlipidemia and low LPL activity.
7713910 1995 Lipoprotein lipase association with lipoproteins involves protein-protein interaction with apolipoprotein B.
7686151 1993 Glycoprotein 330, a member of the low density lipoprotein receptor family, binds lipoprotein lipase in vitro.
7647785 1995 A lipoprotein lipase mutation (Asn291Ser) is associated with reduced HDL cholesterol levels in premature atherosclerosis.
7592875 1995 The very low density lipoprotein receptor mediates the cellular catabolism of lipoprotein lipase and urokinase-plasminogen activator inhibitor type I complexes.
7510694 1994 The carboxyl-terminal domain of lipoprotein lipase binds to the low density lipoprotein receptor-related protein/alpha 2-macroglobulin receptor (LRP) and mediates binding of normal very low density lipoproteins to LRP.
3973011 1985 Modulation of lipoprotein lipase activity by apolipoproteins. Effect of apolipoprotein C-III.
3823907 1987 Human lipoprotein lipase complementary DNA sequence.
3692485 1987 Human genes involved in lipolysis of plasma lipoproteins: mapping of loci for lipoprotein lipase to 8p22 and hepatic lipase to 15q21.
3597382 1987 The sequence of cDNA encoding lipoprotein lipase. A member of a lipase gene family.
3515966 1986 Genotype dependency of adaptation in adipose tissue metabolism after short-term overfeeding.
3355847 1988 Membrane-bound lipoprotein lipase on human monocyte-derived macrophages: localization by immunocolloidal gold technique.
2765475 1989 Structure of the human lipoprotein lipase gene.
2701938 1989 Nucleotide sequence of human cDNA coding for a lipoprotein lipase (LPL) cloned from placental cDNA library.
2536938 1989 A major insertion accounts for a significant proportion of mutations underlying human lipoprotein lipase deficiency.
2349938 1990 Lipoprotein lipase deficiency resulting from a nonsense mutation in exon 3 of the lipoprotein lipase gene.
2340307 1990 Rapid and simple isolation procedure for lipoprotein lipase from human milk.
2294743 1990 Partial gene duplication involving exon-Alu interchange results in lipoprotein lipase deficiency.
2243796 1990 DNA sequence of lipoprotein lipase cDNA cloned from human monocytic leukemia THP-1 cells.
2121025 1990 Compound heterozygote for lipoprotein lipase deficiency: Ser----Thr244 and transition in 3' splice site of intron 2 (AG----AA) in the lipoprotein lipase gene.
2110364 1990 Lipoprotein lipaseBethesda: a single amino acid substitution (Ala-176----Thr) leads to abnormal heparin binding and loss of enzymic activity.
2038366 1991 A mutation in the human lipoprotein lipase gene as the most common cause of familial chylomicronemia in French Canadians.
2010533 1991 Familial chylomicronemia (type I hyperlipoproteinemia) due to a single missense mutation in the lipoprotein lipase gene.
1975597 1990 A missense mutation at codon 188 of the human lipoprotein lipase gene is a frequent cause of lipoprotein lipase deficiency in persons of different ancestries.
1969408 1990 Missense mutation (Gly----Glu188) of human lipoprotein lipase imparting functional deficiency.
1907278 1991 Catalytic triad residue mutation (Asp156----Gly) causing familial lipoprotein lipase deficiency. Co-inheritance with a nonsense mutation (Ser447----Ter) in a Turkish family.
1752947 1991 Heterogeneous mutations in the human lipoprotein lipase gene in patients with familial lipoprotein lipase deficiency.
1737848 1992 Molecular studies on primary lipoprotein lipase (LPL) deficiency. One base deletion (G916) in exon 5 of LPL gene causes no detectable LPL protein due to the absence of LPL mRNA transcript.
1731801 1992 A heterozygous mutation (the codon for Ser447----a stop codon) in lipoprotein lipase contributes to a defect in lipid interface recognition in a case with type I hyperlipidemia.
1730727 1992 Two naturally occurring mutations at the first and second bases of codon aspartic acid 156 in the proposed catalytic triad of human lipoprotein lipase. In vivo evidence that aspartic acid 156 is essential for catalysis.
1702428 1991 Identification of two separate allelic mutations in the lipoprotein lipase gene of a patient with the familial hyperchylomicronemia syndrome.
1674945 1991 Amino acid substitution (Ile194----Thr) in exon 5 of the lipoprotein lipase gene causes lipoprotein lipase deficiency in three unrelated probands. Support for a multicentric origin.
1639392 1992 A missense mutation (Asp250----Asn) in exon 6 of the human lipoprotein lipase gene causes chylomicronemia in patients of different ancestries.
1619366 1992 A missense (Asp250----Asn) mutation in the lipoprotein lipase gene in two unrelated families with familial lipoprotein lipase deficiency.
1598907 1992 A missense mutation (Trp86----Arg) in exon 3 of the lipoprotein lipase gene: a cause of familial chylomicronemia.
1576758 1992 Prevalence, geographical distribution and genealogical investigations of mutation 188 of lipoprotein lipase gene in the French Canadian population of Québec.
1537564 1992 The lipoprotein lipase-encoding human gene: sequence from intron-6 to intron-9 and presence in intron-7 of a 40-million-year-old Alu sequence.
1521525 1992 A missense mutation Pro157 Arg in lipoprotein lipase (LPLNijmegen) resulting in loss of catalytic activity.
1511985 1992 Geographic distribution and genealogy of mutation 207 of the lipoprotein lipase gene in the French Canadian population of Québec.
1479292 1992 Molecular basis of familial chylomicronemia: mutations in the lipoprotein lipase and apolipoprotein C-II genes.
1406652 1992 Characterization of the human lipoprotein lipase (LPL) promoter: evidence of two cis-regulatory regions, LP-alpha and LP-beta, of importance for the differentiation-linked induction of the LPL gene during adipogenesis.
1400331 1992 Missense mutations in exon 5 of the human lipoprotein lipase gene. Inactivation correlates with loss of dimerization.
1371284 1992 Human lipoprotein lipase. Analysis of the catalytic triad by site-directed mutagenesis of Ser-132, Asp-156, and His-241.
1281473 1992 The low density lipoprotein receptor-related protein/alpha 2-macroglobulin receptor binds and mediates catabolism of bovine milk lipoprotein lipase.
182536 1976 Effect of serum and C-apoproteins from very low density lipoproteins on human postheparin plasma hepatic lipase.