Property Summary

NCBI Gene PubMed Count 31
PubMed Score 22.15
PubTator Score 26.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.8e-02
intraductal papillary-mucinous adenoma (... -1.200 9.6e-05
breast carcinoma -1.200 3.4e-03
cystic fibrosis 1.600 2.6e-05
Breast cancer -2.000 4.3e-24
psoriasis -1.600 5.5e-66

Gene RIF (18)

PMID Text
26097573 In hepatocellular carcinoma, low LOXL4 expression was associated with lower overall survival rates and higher cumulative recurrence rates.
25311867 These results provide a set of the essential genes in this newly identified miR-193a-3p/LOXL4/Oxidative Stress axis.
25216702 High Lysyl oxidase-like 4 promotes proliferation and metastasis of gastric cancer via FAK/Src pathway.
24357854 data suggest that abnormal expression of LOXL4 of KCOT may enhance angiogenesis in KCOT, which may help to promote the locally aggressive biological behavior of KCOT.
23357697 TGF-beta1 induced injured MCL to express more LOXs than injured ACL (up to 1.85-fold in LOX, 2.21-fold in LOXL-1, 1.71-fold in LOXL-2, 2.52-fold in LOXL-3 and 3.32-fold in LOXL-4).
22806361 Alternatively spliced lysyl oxidase-like 4 isoforms have a pro-metastatic role in cancer.
21740577 The human lysyl oxidase-like 4 gene does not confer increased genotypic risk for adolescent idiopathic scoliosis.
21733505 SNPs in the lysyl oxidase-like protein 4 and complement component 3 genes are associated with increased risk for endometriosis and endometriosis-associated infertility in a Puerto Rican population.
21115907 Overexpression of the lysyl oxidase-like 4 gene is associated with metastatic head/neck carcinoma.
19015874 In breast carcinoma, LOXL4 was expressed only in the effusion samples. In malignant mesothelioma, LOXL4 and its splice variants were expressed at all sites.
18949373 Functional analysis of the 5' flanking domain of the LOXL4 gene in head and neck squamous cell carcinoma cells.
18586005 These results suggest that LOXL4 may function as a negative feedback regulator of TGF-beta1 in cell invasion by inhibiting the metabolism of extracellular matrix (ECM) components.
18202753 LOXL4-DC stimulated T cells produce higher IFN-gamma secretion compared to unstimulated T cells and T cells stimulated with untransfected DCs, in the presence of the pan-DR-epitope (PADRE)
17671119 Up-regulation of lysyl oxidase mRNA and protein expression is associated with oral squamous cell carcinoma
17287949 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
14551188 LOXL4, with the four scavenger receptor cysteine rich domains, may also function as an active amine oxidase
12894545 The data presented in this work might emphasize the involvement of LOXL4 in molecular processes of the genesis or progression of head and neck carcinomas.

AA Sequence

MAWSPPATLFLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDDNFAIQEATVA      1 - 70
CRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCGSNGWGVSDCSHSEDVGVICHPRRHRGY     71 - 140
LSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMNNSRVVCGMLGFP    141 - 210
SEVPVDSHYYRKVWDLKMRDPKSRLKSLTNKNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGM    211 - 280
HAVVSCVAGPHFRPPKTKPQRKGSWAEEPRVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCR    281 - 350
QLGFGSAREALFGARLGQGLGPIHLSEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQ    351 - 420
VRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWFWSGTPRAQEV    421 - 490
VMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQLVQETAYLEDRPLSQLYCAH    491 - 560
EENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKTGRDSWVWHQCHRHYHSIEVFTHYDLLTLNG    561 - 630
SKVAEGHKASFCLEDTNCPTGLQRRYACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVN    631 - 700
PHYEVAESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNLI                  701 - 756
//

Text Mined References (33)

PMID Year Title
26097573 2015 LOXL4 is downregulated in hepatocellular carcinoma with a favorable prognosis.
25416956 2014 A proteome-scale map of the human interactome network.
25311867 2014 miR-193a-3p regulates the multi-drug resistance of bladder cancer by targeting the LOXL4 gene and the oxidative stress pathway.
25216702 2015 Lysyl oxidase-like 4 (LOXL4) promotes proliferation and metastasis of gastric cancer via FAK/Src pathway.
24357854 2014 Identification of the involvement of LOXL4 in generation of keratocystic odontogenic tumors by RNA-Seq analysis.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23357697 2013 TGF-beta1 induces the different expressions of lysyl oxidases and matrix metalloproteinases in anterior cruciate ligament and medial collateral ligament fibroblasts after mechanical injury.
22806361 2013 Alternatively spliced lysyl oxidase-like 4 isoforms have a pro-metastatic role in cancer.
21740577 2011 Common polymorphisms in human lysyl oxidase genes are not associated with the adolescent idiopathic scoliosis phenotype.
21733505 2011 Single-nucleotide polymorphisms in the lysyl oxidase-like protein 4 and complement component 3 genes are associated with increased risk for endometriosis and endometriosis-associated infertility.
21115907 2010 LOXL4 as a selective molecular marker in primary and metastatic head/neck carcinoma.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19060904 2009 An empirical framework for binary interactome mapping.
19015874 2009 Lysyl oxidase-like 4 is alternatively spliced in an anatomic site-specific manner in tumors involving the serosal cavities.
18949373 2008 Functional analysis of the 5' flanking domain of the LOXL4 gene in head and neck squamous cell carcinoma cells.
18586005 2008 Lysyl oxidase like 4, a novel target gene of TGF-beta1 signaling, can negatively regulate TGF-beta1-induced cell motility in PLC/PRF/5 hepatoma cells.
18202753 2008 Vaccination strategy to target lysyl oxidase-like 4 in dendritic cell based immunotherapy for head and neck cancer.
17671119 2007 Association of expression aberrances and genetic polymorphisms of lysyl oxidase with areca-associated oral tumorigenesis.
17287949 2007 Systematic screening of lysyl oxidase-like (LOXL) family genes demonstrates that LOXL2 is a susceptibility gene to intracranial aneurysms.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14551188 2003 Expression and purification of enzymatically active forms of the human lysyl oxidase-like protein 4.
12894545 Overexpression of a novel lysyl oxidase-like gene in human head and neck squamous cell carcinomas.
12686136 2003 Structural and functional diversity of lysyl oxidase and the LOX-like proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11691589 2001 Cloning and characterization of a fifth human lysyl oxidase isoenzyme: the third member of the lysyl oxidase-related subfamily with four scavenger receptor cysteine-rich domains.
11691588 2001 A novel human lysyl oxidase-like gene (LOXL4) on chromosome 10q24 has an altered scavenger receptor cysteine rich domain.
11292829 2001 Molecular cloning and biological activity of a novel lysyl oxidase-related gene expressed in cartilage.