Property Summary

NCBI Gene PubMed Count 3
PubMed Score 85.84
PubTator Score 21.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.200 3.1e-05
astrocytic glioma -1.400 4.9e-03
atypical teratoid / rhabdoid tumor -1.200 3.3e-05
ependymoma -1.700 1.6e-03
oligodendroglioma -1.300 5.7e-03

AA Sequence

MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPLPVLPRIPSSDCHPRRHS      1 - 70
HEDQEFRCRSHVRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNER     71 - 140
ECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE                                    141 - 178
//

Text Mined References (4)

PMID Year Title