Property Summary

NCBI Gene PubMed Count 35
PubMed Score 65.96
PubTator Score 40.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
psoriasis 6694 6.6e-13
group 4 medulloblastoma 1855 5.6e-06
atypical teratoid / rhabdoid tumor 5112 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 2.2e-02
group 4 medulloblastoma 3.700 5.6e-06
psoriasis -1.100 6.6e-13

Gene RIF (23)

AA Sequence

MLDGLKMEENFQSAIDTSASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLE      1 - 70
TTCFYRDKKLYCKYDYEKLFAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEG     71 - 140
QLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTAEEGKDHKRPKRPRTILTTQQRRAF    141 - 210
KASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGS    211 - 280
AGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGD    281 - 350
CFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS                                          351 - 382
//

Text Mined References (36)

PMID Year Title