Property Summary

NCBI Gene PubMed Count 38
PubMed Score 96.49
PubTator Score 74.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.700 3.7e-06
psoriasis 1.400 2.9e-04
group 3 medulloblastoma 2.100 4.7e-06
atypical teratoid/rhabdoid tumor 1.300 4.3e-08
medulloblastoma, large-cell 2.000 1.6e-06
primitive neuroectodermal tumor 1.500 4.6e-05
Atopic dermatitis 1.400 5.8e-04
non-small cell lung cancer 1.884 8.8e-21
intraductal papillary-mucinous carcinoma... 1.100 1.2e-03
lung cancer 1.300 1.7e-03
colon cancer 1.400 5.2e-03
pediatric high grade glioma 1.100 2.1e-05
Endometriosis 1.332 1.5e-02
Breast cancer 1.200 2.9e-10
ovarian cancer 1.200 2.3e-04

Gene RIF (23)

PMID Text
25954030 Mutation of the nuclear lamin gene LMNB2 in progressive myoclonus epilepsy with early ataxia.
25477337 Nuclear envelope remodelling during human spermiogenesis involves somatic B-type lamins and a spermatid-specific B3 lamin isoform.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of lamin B2 (LMNB2) expression by HIV-1 Vpr in Vpr transduced macrophages
23475125 Treating normal human fibroblasts with farnesyltransferase inhibitors causes the accumulation of unprocessed lamin B2 and lamin A and a decrease in mature lamin B1
22768673 Mutation in LMNB2 gene is associated with partial lipodystrophy.
21400569 Studies indicate that the lamin-binding proteins implicated in laminopathies include lamin B2 and nuclear envelope proteins.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20004208 These findings indicate that a lamin dimer principally has the freedom for a "combinatorial" head-to-tail association with all types of lamins, a property that might be of significant importance for the assembly of the nuclear lamina.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
17290216 The human DNA replication origin, located in the lamin B2 gene, interacts with the DNA topoisomerases I and II in a cell cycle-modulated manner.
17070523 human lamin B(2) is indeed synthesized as a longer version than previously reported, because it contains these additional 20 amino acids
16826530 Three new rare heterozygous mutations are the first reported for LMNB2 and are the first reported among patients with acquired partial lipodystrophy.
16543417 lamin B was essential for the formation of the mitotic matrix that tethers a number of spindle assembly factors; propose that lamin B is a structural component of the spindle matrix that promotes microtubule assembly and organization in mitosis
15611042 the lamin B2 origin adopts a structure partly composed of intramolecular TAT triads
15284226 the distinctive ensemble of heterotypic lamin interactions in a particular cell type affects the stability of the lamin polymer
15024083 This analysis reveals the modular structure of the lamin B2 origin and supports the idea that sequence elements close to the replication start site play an important role in origin activation.
12912926 The proteins bound in vivo at the LMNB2 replication origin were investigated along the cell cycle.
12902329 analysis of protein-DNA interactions at the human lamin B2 replication origin
11691994 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of lamin B2 (LMNB2) expression by HIV-1 Vpr in Vpr transduced macrophages
9436978 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of lamin B2 (LMNB2) expression by HIV-1 Vpr in Vpr transduced macrophages
2544227 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of lamin B2 (LMNB2) expression by HIV-1 Vpr in Vpr transduced macrophages
2406262 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of lamin B2 (LMNB2) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MSPPSPGRRREQRRPRAAATMATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE      1 - 70
NDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREG     71 - 140
ELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLEN    141 - 210
RCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQ    211 - 280
TYQAKLDSAKLSSDQNDKAASAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFR    281 - 350
KMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSS    351 - 420
SSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKN    421 - 490
NSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESF    491 - 560
RTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM              561 - 620
//

Text Mined References (53)

PMID Year Title
25954030 2015 Mutation of the nuclear lamin gene LMNB2 in progressive myoclonus epilepsy with early ataxia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25477337 2015 Nuclear envelope remodelling during human spermiogenesis involves somatic B-type lamins and a spermatid-specific B3 lamin isoform.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23475125 Disruption of lamin B1 and lamin B2 processing and localization by farnesyltransferase inhibitors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22768673 2012 A Chinese patient with acquired partial lipodystrophy caused by a novel mutation with LMNB2 gene.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21400569 2011 Laminopathies and lamin-associated signaling pathways.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20004208 2010 Characterization of the head-to-tail overlap complexes formed by human lamin A, B1 and B2 "half-minilamin" dimers.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17290216 2007 Functional interactions of DNA topoisomerases with a human replication origin.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17070523 2006 Identification of a novel, highly variable amino-terminal amino acid sequence element in the nuclear intermediate filament protein lamin B(2) from higher vertebrates.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16826530 2006 Sequencing of the reannotated LMNB2 gene reveals novel mutations in patients with acquired partial lipodystrophy.
16543417 2006 A mitotic lamin B matrix induced by RanGTP required for spindle assembly.
16341674 2005 Transcriptome analysis of human gastric cancer.
15611042 2005 Noncanonical DNA elements in the lamin B2 origin of DNA replication.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15284226 2004 The stability of the nuclear lamina polymer changes with the composition of lamin subtypes according to their individual binding strengths.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15024083 2004 Modular structure of the human lamin B2 replicator.
12912926 2003 Localization of proteins bound to a replication origin of human DNA along the cell cycle.
12902329 2003 In vitro protein-DNA interactions at the human lamin B2 replication origin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11691994 2001 Dynamic disruptions in nuclear envelope architecture and integrity induced by HIV-1 Vpr.
11207047 2001 Expression of individual lamins in basal cell carcinomas of the skin.
10960149 2000 The inner nuclear membrane.
10835276 2000 Selection of homeotic proteins for binding to a human DNA replication origin.
10806082 2000 Review: nuclear lamins--structural proteins with fundamental functions.
9436978 1998 HIV-1 Vpr interacts with the nuclear transport pathway to promote macrophage infection.
9243284 1997 A- and B-type lamins are differentially expressed in normal human tissues.
8543011 1995 S-phase phosphorylation of lamin B2.
3515346 1986 Biogenesis of the nuclear lamina: in vivo synthesis and processing of nuclear protein precursors.
2544227 1989 Association of Tat protein and viral mRNA with nuclear matrix from HIV-1-infected H9 cells.
2406262 1990 Functional characterization of Tat protein from human immunodeficiency virus. Evidence that Tat links viral RNAs to nuclear matrix.
1939065 1991 Identification of lamin B2 as a substrate of protein kinase C in BALB/MK-2 mouse keratinocytes.
1630457 1992 The gene for a novel human lamin maps at a highly transcribed locus of chromosome 19 which replicates at the onset of S-phase.
1291239 1992 A human DNA replication origin: localization and transcriptional characterization.
924328 1977 [Vulvar neoplasms and preoperative lymphography].