Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.27
PubTator Score 4.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 8.0e-06

Synonym

Accession Q9Y234 Q4ZFZ1
Symbols LIPT1D

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (3)

AA Sequence

MLIPFSMKNCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLEGKPILFFWQNSP      1 - 70
SVVIGRHQNPWQECNLNLMREEGIKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLIVRALNAV     71 - 140
QPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDGTFLSSLLKSPYQGIRSNATASIPS    141 - 210
LVKNLLEKDPTLTCEVLMNAVATEYAAYHQIDNHIHLINPTDETLFPGINSKAKELQTWEWIYGKTPKFS    211 - 280
INTSFHVLYEQSHLEIKVFIDIKNGRIEICNIEAPDHWLPLEIRDKLNSSLIGSKFCPTETTMLTNILLR    281 - 350
TCPQDHKLNSKWNILCEKIKGIM                                                   351 - 373
//

Text Mined References (13)

PMID Year Title