Property Summary

NCBI Gene PubMed Count 94
PubMed Score 412.32
PubTator Score 308.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.500 1.1e-03
Atopic dermatitis -1.100 3.0e-02
breast carcinoma -2.900 7.2e-04
fibroadenoma -3.800 3.9e-03
group 3 medulloblastoma -1.100 3.6e-02
subependymal giant cell astrocytoma -1.106 2.9e-02
ductal carcinoma in situ -3.700 4.4e-04
invasive ductal carcinoma -4.200 2.0e-03
ovarian cancer 1.100 2.3e-07

Protein-protein Interaction (4)

Gene RIF (72)

PMID Text
25819461 Despite reductions in intramyocellular lipolysis and HSL expression, overexpression of HSL did not rescue defects in insulin action in skeletal myotubes from obese type 2 diabetic subjects.
25475467 Identification of a homozygous nonsense variant p.Ala507fsTer563 in hormone sensitive lipase as the likely cause of the lipodystrophy phenotype in siblings.
24848981 These findings indicate the physiological significance of HSL in adipocyte function and the regulation of systemic lipid and glucose homeostasis and underscore the severe metabolic consequences of impaired lipolysis.
23688034 Serum triglyceride was significantly up-regulated in men with the (CG + GG) genotype of HSL promoter polymorphism.
22553833 M. leprae suppresses lipid degradation through inhibition of HSL expression.
21933124 Enzyme promiscuity in the hormone-sensitive lipase family of proteins.
21919688 suggests that genetic variation of HSL may be a risk factor for male infertility
21826994 LIPE C-60G variation can inhibit the decrease of LDL-C and the increases of HDL-C and apo A-I in young healthy males, and can inhibit the decrease of LDL-C and the increase of insulin in young healthy females induced by a high-carbohydrate diet.
21680814 total lipase, ATGL and HSL activities were higher in visceral white adipose tissue of cancer patients compared with individuals without cancer and higher in cancer patients with cachexia compared with cancer patients without cachexia
21543206 Resveratrol increased adipose triglyceride lipase gene and protein expressions, an effect that was not observed for hormone-sensitive lipase in human SGBS adipocytes.
21498783 Data indicate that altered ATGL and HSL expression in skeletal muscle could promote DAG accumulation and disrupt insulin signaling and action.
21241784 Studies indicate tha HSL is regulated by reversible phosphorylation on five critical residues.
21081692 It is concluded that ACTH via the PKA pathway stimulates expression of SF-1, which activates transcription of LIPE presumably by interaction with putative binding sequences within promoter A
20926921 Data show that hormone-sensitive lipase activity is reduced in adipose tissue of patients with and without diabetes, while lipoprotein lipase activity is reduces only in patients with diabetes.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20495294 Those findings indicate improvement and conservation of lifestyle depending on genetic predisposition in ADIPOQ, PLIN and LIPE should be encouraged.
20495294 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20017959 The present study aimed at comparing expression and subcellular distribution of perilipin and hormone-sensitive lipase in two abdominal adipose tissues of lean and obese women.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19695247 TNFalpha decreased ATGL and HSL protein content and triglycerides (TG)-hydrolase activity but increased basal lipolysis due to a marked reduction in perilipin (PLIN) protein content
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19433586 results suggest that ATGL/CGI-58 acts independently of HSL and precedes its action in the sequential hydrolysis of triglycerides in human hMADS adipocytes
19369647 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19164092 These results suggest that the associations between physical activity and body fat and plasma lipoprotein/lipid concentrations in men are dependent on the LIPE C-60G polymorphism,.
19164092 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19018281 PKA activates human HSL against lipid substrates in vitro primarily through phosphorylation of Ser649 and Ser650
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18824087 analysis of human, mouse and ovine Hormone Sensitive Lipase
18820256 Mapping of the hormone-sensitive lipase binding site on the adipocyte fatty acid-binding protein (AFABP). Identification of the charge quartet on the AFABP/aP2 helix-turn-helix domain.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18398140 Obesity is accompanied by impaired fasting glycerol release, lower HSL protein expression, and serine phosphorylation.
18383440 Real-time PCR revealed that large adipocytes expressed higher mRNA levels of hormone sensitive lipase.
18249203 variation of the HSL gene might be associated with a physiological effect on in vivo beta-adrenoceptor-mediated fat oxidation
18249203 Observational study of gene-disease association. (HuGE Navigator)
17587400 Dydrogesterone and norethisterone increase secretion of HSL from abdominaal adipocytes.
17356053 In obese subjects, insulin resistance and hyperinsulinemia are strongly associated with ATGL and HSL mRNA and protein expression, independent of fat mass
17327373 Adipose triglyceride lipase (ATGL) is less important than hormone-sensitive lipase (HSL) in regulating catecholamine-induced lipolysis. Both lipases regulate basal lipolysis in human adipocytes. ATGL expression is not influenced by obesity or PCOS.
17318300 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17318300 The combined effect of LIPC, LIPE and ApoCIII gene polymorphisms may increase the likelihood of gestational hypertension, but seemingly not of preeclampsia.
17074755 Adipose triglyceride lipase and hormone sensitive lipase are responsible for more than 95% of the triacylglycerol hydrolase activity present in murine white adipose tissue.
17026959 hormone-sensitive lipase
16940551 maternal type 1 diabetes is associated with TG accumulation and increased EL and HSL gene expression in placenta
16822962 although HSL expression and Ser(659) phosphorylation in skeletal muscle during exercise is sex specific, total muscle HSL activity measured in vitro was similar between sexes
16752181 HSL gene expression shows a regulation according to obesity status and is associated with increased adipose tissue lipase activity.
16690773 adrenergic stimulation contributes to the increase in HSL activity that occurs in human skeletal muscle in the first minute of exercise at 65% and 90% VO2 peak
16534522 Observational study of gene-disease association. (HuGE Navigator)
16534522 the HSL C-60G polymorphism is associated with increased waist circumference in non-obese subjects
16243839 Perilipin targets a novel pool of lipid droplets for lipolytic attack by hormone-sensitive lipase
15871848 Observational study of gene-disease association. (HuGE Navigator)
15609025 Basal HSL is decreased in patients with type 2 diabetes mellitus, and this may be a consequence of elevated plasma insulin levels.
15456755 a pre-lipolysis complex containing at least AFABP and HSL exists
15345679 mechanism of infertility in HSL-deficient males is cell autonomous and resides in postmeiotic germ cells, because HSL expression in these cells is in itself sufficient to restore normal fertility
15308678 5'AMP-activated protein kinase phosphorylates hormone-sensitive lipase on Ser565 in human skeletal muscle during exercise with reduced muscle glycogen. Apparently, HSL Ser565 phosphorylation by AMPK during exercise
15260473 catalytic serine of hormone-sensitive lipase is highly reactive and similar behavior was also observed with lipases with no lid domain covering their active site, or with a deletion in the lid domain
15231718 AMPK is a major regulator of skeletal muscle HSL activity that can override beta-adrenergic stimulation
14984467 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12970365 role of cyclic GMP in natriuretic peptide-mediated phosphorylation in adipocytes
12765952 The presence of a catalytically inactive variant of this enzyme is associated with decreased lipolysis in abdominal subcutaneous adipose tissue of obese subjects
12730334 High adrenaline levels can stimulate hormone-sensitive lipase(HSL) activity regardless of metabolic milieu. Large increases in adrenaline during exercise are able to further stimulate contraction-induced increase in HSL activity.
12727985 lipolytic catecholamine resistance of sc adipocytes in polycystic ovary syndrome is probably due to a combination of decreased amounts of beta(2)-adrenergic receptors, the regulatory II beta-component of protein kinase A, and hormone-sensitive lipase
12701046 high concentrations of estradiol significantly increased both hormone-sensitive lipase expression and glycerol release relative to control
12534454 Observational study of gene-disease association. (HuGE Navigator)
12534454 HSL i6 A5 HOMOZYGOSITY IS A RISK FACTOR FOR BODY FAT ACCUMULATION
12518034 overexpression of HSL, despite increased lipase activity, does not lead to enhanced lipolysis
12514936 Observational study of gene-disease association. (HuGE Navigator)
11979403 genes of C3, hormone-sensitive lipase, and PPARgamma may exert a modifying effect on lipid and glucose metabolism in familial combined hypersensitivity
11850754 Observational study of gene-disease association. (HuGE Navigator)
11731226 Observational study of gene-disease association. (HuGE Navigator)
11574428 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPGSKSVSRSDWQPEPHQRPITPLEPGPEKTPIAQPESKTLQGSNTQQKPASNQRPLTQQETPAQHDAE      1 - 70
SQKEPRAQQKSASQEEFLAPQKPAPQQSPYIQRVLLTQQEAASQQGPGLGKESITQQEPALRQRHVAQPG     71 - 140
PGPGEPPPAQQEAESTPAAQAKPGAKREPSAPTESTSQETPEQSDKQTTPVQGAKSKQGSLTELGFLTKL    141 - 210
QELSIQRSALEWKALSEWVTDSESESDVGSSSDTDSPATMGGMVAQGVKLGFKGKSGYKVMSGYSGTSPH    211 - 280
EKTSARNHRHYQDTASRLIHNMDLRTMTQSLVTLAEDNIAFFSSQGPGETAQRLSGVFAGVREQALGLEP    281 - 350
ALGRLLGVAHLFDLDPETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALT    351 - 420
QLRALVYYAQRLLVTNRPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRPFLQTISIGLV    421 - 490
SFGEHYKRNETGLSVAASSLFTSGRFAIDPELRGAEFERITQNLDVHFWKAFWNITEMEVLSSLANMASA    491 - 560
TVRVSRLLSLPPEAFEMPLTADPTLTVTISPPLAHTGPGPVLVRLISYDLREGQDSEELSSLIKSNGQRS    561 - 630
LELWPRPQQAPRSRSLIVHFHGGGFVAQTSRSHEPYLKSWAQELGAPIISIDYSLAPEAPFPRALEECFF    631 - 700
AYCWAIKHCALLGSTGERICLAGDSAGGNLCFTVALRAAAYGVRVPDGIMAAYPATMLQPAASPSRLLSL    701 - 770
MDPLLPLSVLSKCVSAYAGAKTEDHSNSDQKALGMMGLVRRDTALLLRDFRLGASSWLNSFLELSGRKSQ    771 - 840
KMSEPIAEPMRRSVSEAALAQPQGPLGTDSLKNLTLRDLSLRGNSETSSDTPEMSLSAETLSPSTPSDVN    841 - 910
FLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSML    911 - 980
KSLPPVHIVACALDPMLDDSVMLARRLRNLGQPVTLRVVEDLPHGFLTLAALCRETRQAAELCVERIRLV    981 - 1050
LTPPAGAGPSGETGAAGVDGGCGGRH                                               1051 - 1076
//

Text Mined References (97)

PMID Year Title
25819461 2015 Primary defects in lipolysis and insulin action in skeletal muscle cells from type 2 diabetic individuals.
25475467 2014 A novel LIPE nonsense mutation found using exome sequencing in siblings with late-onset familial partial lipodystrophy.
24848981 2014 Null mutation in hormone-sensitive lipase gene and risk of type 2 diabetes.
23688034 2013 Risk interaction of obesity, insulin resistance and hormone-sensitive lipase promoter polymorphisms (LIPE-60 C > G) in the development of fatty liver.
22553833 2012 Essential role of hormone-sensitive lipase (HSL) in the maintenance of lipid storage in Mycobacterium leprae-infected macrophages.
21933124 2012 Enzyme promiscuity in the hormone-sensitive lipase family of proteins.
21919688 2011 Genetic variation of hormone sensitive lipase and male infertility.
21826994 2011 [Effects of the LIPE C-60G polymorphism on changes of plasma lipids and glucose induced by a high-carbohydrate diet in healthy youth].
21680814 2011 Adipose triglyceride lipase contributes to cancer-associated cachexia.
21543206 2012 Resveratrol regulates lipolysis via adipose triglyceride lipase.
21498783 2011 Altered skeletal muscle lipase expression and activity contribute to insulin resistance in humans.
21241784 2011 The resurgence of Hormone-Sensitive Lipase (HSL) in mammalian lipolysis.
21081692 2011 Transcription of LIPE gene encoding hormone-sensitive lipase/cholesteryl esterase is regulated by SF-1 in human adrenocortical cells: involvement of protein kinase A signal transduction pathway.
20926921 2011 Fasting and post-prandial adipose tissue lipoprotein lipase and hormone-sensitive lipase in obesity and type 2 diabetes.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20495294 2010 Association of lifestyle factors, polymorphisms in adiponectin, perilipin and hormone sensitive lipase, and clinical markers in Japanese males.
20017959 2009 Depot-specific differences in perilipin and hormone-sensitive lipase expression in lean and obese.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19695247 2009 Chronic TNFalpha and cAMP pre-treatment of human adipocytes alter HSL, ATGL and perilipin to regulate basal and stimulated lipolysis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19433586 2009 Contribution of adipose triglyceride lipase and hormone-sensitive lipase to lipolysis in hMADS adipocytes.
19369647 2009 Identification of potentially damaging amino acid substitutions leading to human male infertility.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19164092 2009 LIPE C-60G influences the effects of physical activity on body fat and plasma lipid concentrations: the Quebec Family Study.
19018281 2008 Ser649 and Ser650 are the major determinants of protein kinase A-mediated activation of human hormone-sensitive lipase against lipid substrates.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18824087 2008 Cloning and functional characterization of the 5' regulatory region of ovine Hormone Sensitive Lipase (HSL) gene.
18820256 2008 Mapping of the hormone-sensitive lipase binding site on the adipocyte fatty acid-binding protein (AFABP). Identification of the charge quartet on the AFABP/aP2 helix-turn-helix domain.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18398140 2008 Hormone-sensitive lipase serine phosphorylation and glycerol exchange across skeletal muscle in lean and obese subjects: effect of beta-adrenergic stimulation.
18383440 2008 Differences in the amount of lipolysis induced by atrial natriuretic peptide in small and large adipocytes.
18249203 2008 Blunted beta-adrenoceptor-mediated fat oxidation in overweight subjects: a role for the hormone-sensitive lipase gene.
17587400 2007 Dydrogesterone and norethisterone regulate expression of lipoprotein lipase and hormone-sensitive lipase in human subcutaneous abdominal adipocytes.
17356053 2007 Adipose triglyceride lipase and hormone-sensitive lipase protein expression is decreased in the obese insulin-resistant state.
17327373 2007 Comparative studies of the role of hormone-sensitive lipase and adipose triglyceride lipase in human fat cell lipolysis.
17318300 2007 The combination of ApoCIII, hepatic lipase and hormono sensitive lipase gene polymorphisms suggests an association with susceptibility to gestational hypertension.
17074755 2006 Adipose triglyceride lipase and hormone-sensitive lipase are the major enzymes in adipose tissue triacylglycerol catabolism.
17026959 2006 Association and insulin regulated translocation of hormone-sensitive lipase with PTRF.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16940551 2006 Placental triglyceride accumulation in maternal type 1 diabetes is associated with increased lipase gene expression.
16906479 2006 PPARgamma agonism increases rat adipose tissue lipolysis, expression of glyceride lipases, and the response of lipolysis to hormonal control.
16822962 2006 Sex differences in hormone-sensitive lipase expression, activity, and phosphorylation in skeletal muscle at rest and during exercise.
16803459 2006 Separation and characterization of caveolae subclasses in the plasma membrane of primary adipocytes; segregation of specific proteins and functions.
16752181 2006 Human adipose triglyceride lipase (PNPLA2) is not regulated by obesity and exhibits low in vitro triglyceride hydrolase activity.
16690773 2006 Adrenergic regulation of HSL serine phosphorylation and activity in human skeletal muscle during the onset of exercise.
16534522 2006 The hormone-sensitive lipase C-60G promoter polymorphism is associated with increased waist circumference in normal-weight subjects.
16328496 2006 Changes in mammary fat pad composition and lipolytic capacity throughout pregnancy.
16243839 2005 Perilipin targets a novel pool of lipid droplets for lipolytic attack by hormone-sensitive lipase.
15871848 2005 Investigation into the role of the hormone sensitive lipase -60C>G promoter variant in morbid obesity.
15697220 2005 Mutational analysis of the "regulatory module" of hormone-sensitive lipase.
15654127 2005 Expression, activity, and localization of hormone-sensitive lipase in rat mammary gland during pregnancy and lactation.
15627655 2005 Sensitive assay for hormone-sensitive lipase using NBD-labeled monoacylglycerol to detect low activities in rat adipocytes.
15609025 2005 Hormone-sensitive lipase is reduced in the adipose tissue of patients with type 2 diabetes mellitus: influence of IL-6 infusion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456755 2004 Physical association between the adipocyte fatty acid-binding protein and hormone-sensitive lipase: a fluorescence resonance energy transfer analysis.
15345679 2004 Expression of human hormone-sensitive lipase (HSL) in postmeiotic germ cells confers normal fertility to HSL-deficient mice.
15308678 2004 Regulation of hormone-sensitive lipase activity and Ser563 and Ser565 phosphorylation in human skeletal muscle during exercise.
15260473 2004 Might the kinetic behavior of hormone-sensitive lipase reflect the absence of the lid domain?
15231718 2004 Beta-adrenergic stimulation of skeletal muscle HSL can be overridden by AMPK signaling.
14984467 2004 Genetic variation at the hormone sensitive lipase: gender-specific association with plasma lipid and glucose concentrations.
14745722 2004 Normal and pathological human testes express hormone-sensitive lipase and the lipid receptors CLA-1/SR-BI and CD36.
14641008 2003 Molecular mechanisms regulating hormone-sensitive lipase and lipolysis.
12970365 2003 Involvement of a cGMP-dependent pathway in the natriuretic peptide-mediated hormone-sensitive lipase phosphorylation in human adipocytes.
12925534 2003 Interaction of hormone-sensitive lipase with steroidogenic acute regulatory protein: facilitation of cholesterol transfer in adrenal.
12864745 2003 Hormone-sensitive lipase in skeletal muscle: regulatory mechanisms.
12832420 2003 Mutational analysis of the hormone-sensitive lipase translocation reaction in adipocytes.
12765952 2003 The presence of a catalytically inactive form of hormone-sensitive lipase is associated with decreased lipolysis in abdominal subcutaneous adipose tissue of obese subjects.
12730334 2003 Effects of plasma adrenaline on hormone-sensitive lipase at rest and during moderate exercise in human skeletal muscle.
12727985 2003 Mechanisms behind lipolytic catecholamine resistance of subcutaneous fat cells in the polycystic ovarian syndrome.
12701046 2003 17Beta-estradiol and anti-estrogen ICI:compound 182,780 regulate expression of lipoprotein lipase and hormone-sensitive lipase in isolated subcutaneous abdominal adipocytes.
12562895 2003 Effects of dynamic exercise intensity on the activation of hormone-sensitive lipase in human skeletal muscle.
12534454 2002 The hormone-sensitive lipase i6 gene polymorphism and body fat accumulation.
12518034 2003 Expression of human hormone-sensitive lipase in white adipose tissue of transgenic mice increases lipase activity but does not enhance in vitro lipolysis.
12514936 2002 Association of the hormone sensitive lipase -60C > G variant with fasting insulin levels in healthy young men.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12364542 2002 Hormone-sensitive lipase: control of intracellular tri-(di-)acylglycerol and cholesteryl ester hydrolysis.
11979403 2002 C3, hormone-sensitive lipase, and peroxisome proliferator-activated receptor gamma expression in adipose tissue of familial combined hyperlipidemia patients.
11850754 2002 The hormone-sensitive lipase gene and body composition: the HERITAGE Family Study.
11846402 2002 Characterization of a novel testicular form of human hormone-sensitive lipase.
11812735 2002 Transcriptional regulation of adipocyte hormone-sensitive lipase by glucose.
11791141 2002 Hormone sensitive lipase expression and adipose tissue metabolism show gender difference in obese subjects after weight loss.
11731226 2001 Variation in the promoter of the human hormone sensitive lipase gene shows gender specific effects on insulin and lipid levels: results from the Ely study.
11581251 2001 Stimulation of lipolysis and hormone-sensitive lipase via the extracellular signal-regulated kinase pathway.
11574428 2001 A common hormone-sensitive lipase i6 gene polymorphism is associated with decreased human adipocyte lipolytic function.
11063252 2000 The hormone-sensitive lipase gene is transcribed from at least five alternative first exons in mouse adipose tissue.
11026666 2000 Hormone sensitive lipase mRNA in both monocyte and macrophage forms of the human THP-1 cell line.
10694408 2000 Hormone-sensitive lipase functions as an oligomer.
10445032 1999 Lipotransin: a novel docking protein for hormone-sensitive lipase.
10318917 1999 Interaction of rat hormone-sensitive lipase with adipocyte lipid-binding protein.
9417067 1998 Identification of novel phosphorylation sites in hormone-sensitive lipase that are phosphorylated in response to isoproterenol and govern activation properties in vitro.
8812477 1996 Molecular cloning, genomic organization, and expression of a testicular isoform of hormone-sensitive lipase.
8506334 1993 Gene organization and primary structure of human hormone-sensitive lipase: possible significance of a sequence homology with a lipase of Moraxella TA144, an antarctic bacterium.
7698015 1995 Mapping of the gene for hormone sensitive lipase (LIPE) to chromosome 19q13.1-->q13.2.
3420405 1988 Hormone-sensitive lipase: sequence, expression, and chromosomal localization to 19 cent-q13.3.