Property Summary

Ligand Count 257
NCBI Gene PubMed Count 95
PubMed Score 464.80
PubTator Score 308.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Lipodystrophy, Familial Partial 8 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Familial partial lipodystrophy 12 0.0 5.0
Disease Target Count Z-score Confidence
Obesity 678 5.528 2.8
diabetes mellitus 1728 3.796 1.9
Disease Target Count
Familial partial lipodystrophy 6 1

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis -1.100 3.0e-02
breast carcinoma -2.900 7.2e-04
ductal carcinoma in situ -3.700 4.4e-04
fibroadenoma -3.800 3.9e-03
group 3 medulloblastoma -1.100 3.6e-02
invasive ductal carcinoma -4.200 2.0e-03
ovarian cancer 1.100 2.3e-07
psoriasis 1.500 1.1e-03
subependymal giant cell astrocytoma -1.106 2.9e-02

Gene RIF (73)

AA Sequence

MEPGSKSVSRSDWQPEPHQRPITPLEPGPEKTPIAQPESKTLQGSNTQQKPASNQRPLTQQETPAQHDAE      1 - 70
SQKEPRAQQKSASQEEFLAPQKPAPQQSPYIQRVLLTQQEAASQQGPGLGKESITQQEPALRQRHVAQPG     71 - 140
PGPGEPPPAQQEAESTPAAQAKPGAKREPSAPTESTSQETPEQSDKQTTPVQGAKSKQGSLTELGFLTKL    141 - 210
QELSIQRSALEWKALSEWVTDSESESDVGSSSDTDSPATMGGMVAQGVKLGFKGKSGYKVMSGYSGTSPH    211 - 280
EKTSARNHRHYQDTASRLIHNMDLRTMTQSLVTLAEDNIAFFSSQGPGETAQRLSGVFAGVREQALGLEP    281 - 350
ALGRLLGVAHLFDLDPETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALT    351 - 420
QLRALVYYAQRLLVTNRPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRPFLQTISIGLV    421 - 490
SFGEHYKRNETGLSVAASSLFTSGRFAIDPELRGAEFERITQNLDVHFWKAFWNITEMEVLSSLANMASA    491 - 560
TVRVSRLLSLPPEAFEMPLTADPTLTVTISPPLAHTGPGPVLVRLISYDLREGQDSEELSSLIKSNGQRS    561 - 630
LELWPRPQQAPRSRSLIVHFHGGGFVAQTSRSHEPYLKSWAQELGAPIISIDYSLAPEAPFPRALEECFF    631 - 700
AYCWAIKHCALLGSTGERICLAGDSAGGNLCFTVALRAAAYGVRVPDGIMAAYPATMLQPAASPSRLLSL    701 - 770
MDPLLPLSVLSKCVSAYAGAKTEDHSNSDQKALGMMGLVRRDTALLLRDFRLGASSWLNSFLELSGRKSQ    771 - 840
KMSEPIAEPMRRSVSEAALAQPQGPLGTDSLKNLTLRDLSLRGNSETSSDTPEMSLSAETLSPSTPSDVN    841 - 910
FLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSML    911 - 980
KSLPPVHIVACALDPMLDDSVMLARRLRNLGQPVTLRVVEDLPHGFLTLAALCRETRQAAELCVERIRLV    981 - 1050
LTPPAGAGPSGETGAAGVDGGCGGRH                                               1051 - 1076
//

Text Mined References (98)

PMID Year Title