Property Summary

NCBI Gene PubMed Count 7
PubMed Score 86.12
PubTator Score 10.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.700 5.0e-03
group 4 medulloblastoma 1.100 4.0e-03
hepatocellular carcinoma 1.800 2.8e-05
intraductal papillary-mucinous adenoma (... 1.400 8.2e-03
osteosarcoma -1.408 8.0e-04
ovarian cancer -2.900 2.8e-09
pancreatic cancer 1.400 1.6e-02
pancreatic carcinoma 1.400 1.6e-02
Pick disease 1.100 8.1e-04
progressive supranuclear palsy 1.100 5.1e-03
spina bifida -1.266 4.1e-02
tuberculosis -1.200 9.6e-03

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MKVFCEVLEELYKKVLLGATLENDSHDYIFYLNPAVSDQDCSTATSLEWANTCGIQGRHQPISVGVAPIA      1 - 70
VAPVCLKTNSQMSGSREVMLLQLTVIKVMTTRILSVKTEFHAKEQYRDVIKILLESAKVDSKLICMFQNS     71 - 140
DKLLSHMAAQCLALLLYFQLREKITLSNSWIAFCQKNLSEYSESNKAIYCLWTLTAIIKEIFKDSCSQKT    141 - 210
EILKQFLTHFDTIFEVFYNSLFSQHFENCRDTSKIVNILMCFLDLLELLIASRIHLKLHFTCQRILFLKP    211 - 280
SCMLEVITWPIQAFVKRKVIIFLKKCLLCKVGEDLCRGSVPALMPPDHHVAVDMLALANAVLQAVNSGLL    281 - 350
KTLSVYEKHSFFGGDEVQPECELITSPDHVILRAASLVIMKSLEIKFQNYSSASEVKVDLQRFMSELLTF    351 - 420
LKPHLQPSLQLHNPCKWLSRVFIEQDDDMLEAAKASLGIYLTLTRGCEATESLTQGKEMWDHHTHENGYN    421 - 490
PHCIFLFFLKNIGFDSTVLLDFLISSETCFLEYFVRYLKLLQKDWDNFFTICNNFDATESKYDISICGCV    491 - 560
PSLVQDQSSNQTIPHRLTAPHSHRDVCARHSWASDAPSEPLKAVMSKGAHTMCASSLSSPRASQSLVDYD    561 - 630
SSDDSDVESTEQCLANSKQTSLHQQATKEIQDAAGTSRDKKEFSLEPPSRPLVLKEFDTAFSFDCEVAPN    631 - 700
DVVSEVGIFYRIVKCFQELQDAICRLQKKNLFPYNPTALLKLLKYIEVISNKTMNTL                 701 - 757
//

Text Mined References (10)

PMID Year Title