Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.67
PubTator Score 10.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.500 1.6e-03
posterior fossa group A ependymoma -3.300 1.3e-11
oligodendroglioma -2.400 3.7e-03
glioblastoma -3.600 9.5e-06
atypical teratoid / rhabdoid tumor -2.200 3.9e-03
primitive neuroectodermal tumor -2.500 3.5e-03
interstitial cystitis -1.300 4.9e-04
pediatric high grade glioma -3.100 4.3e-06
pilocytic astrocytoma -3.200 5.5e-07
lung carcinoma 2.100 1.2e-13
ovarian cancer -1.100 7.4e-04
psoriasis -2.700 2.0e-44

Gene RIF (8)

PMID Text
25711307 Data indicate that rs10968576, an intronic single nucleotide polymorphism (SNP) within the leucine rich repeat and Ig domain containing 2 LINGO2 (LERN3, LRRN6C) gene was associated with body mass in elderly Swedes at age 70.
22123311 The results of this study concluded that the LINGO-2 variant rs109668280 does not contribute to the risk of developing parkinson disreas in Taiwan.
21287203 demonstrated for the first time that rs7033345 is associated with PD and ET and rs10812774 with ET among Asians, suggesting that LINGO2 might act as a susceptibility gene for essential tremor and Parkinson's disease
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20369371 LINGO1 and LINGO2 variants are associated with essential tremor and Parkinson disease
20369371 Observational study of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLK      1 - 70
SVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENK     71 - 140
IVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKH    141 - 210
LNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVTNTNLSTVPFLAFKHLVYLTHLNL    211 - 280
SYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVL    281 - 350
SINNNPLACDCRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHL    351 - 420
LVDEGQTVQLECSADGDPQPVISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAG    421 - 490
NDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCFTFLGVVLFCF    491 - 560
LLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI                            561 - 606
//

Text Mined References (21)

PMID Year Title
25711307 2015 Association of the LINGO2-related SNP rs10968576 with body mass in a cohort of elderly Swedes.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
24390345 2014 Sequence variants in SLC16A11 are a common risk factor for type 2 diabetes in Mexico.
24096698 2014 Genome-wide association study of endometrial cancer in E2C2.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22123311 2012 LINGO-2 polymorphism and the risk of Parkinson's disease in Taiwan.
21287203 2011 Lingo2 variants associated with essential tremor and Parkinson's disease.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20369371 2010 LINGO1 and LINGO2 variants are associated with essential tremor and Parkinson disease.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14686891 2003 LRRN6A/LERN1 (leucine-rich repeat neuronal protein 1), a novel gene with enriched expression in limbic system and neocortex.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.