Property Summary

NCBI Gene PubMed Count 84
PubMed Score 99.95
PubTator Score 94.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
group 3 medulloblastoma 2254 1.4e-06
pilocytic astrocytoma 3086 1.5e-05
glioblastoma 5572 3.1e-04
cystic fibrosis 1670 2.2e-03
medulloblastoma, large-cell 6234 4.8e-02
Disease Target Count Z-score Confidence
Neuroblastoma 78 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.965 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 4.100 1.4e-06
glioblastoma -1.300 3.1e-04
medulloblastoma, large-cell 1.900 4.8e-02
cystic fibrosis 1.900 2.2e-03
pilocytic astrocytoma -1.200 1.5e-05

Gene RIF (73)

PMID Text
27383785 let-7 disruption by LIN28B, MYCN sponging, or genetic loss is a unifying mechanism of neuroblastoma development with broad implications for cancer pathogenesis
26751131 suggest that molecular subtypes of the LIN-28B/let-7a/IGF-II axis associate with heterogeneous progression
26712910 elevated LIN28B expression as a hallmark of a novel fetal-like subgroup in Juvenile myelomonocytic leukemia.
26481147 Data show that RNA-binding protein LIN28B coordinates the expression of the oncogene RAN protein and aurora A kinase (AURKA) in neuroblastoma.
26158423 Testing for a combination of elevated IMP3 and Lin28B levels could further facilitate the identification of a patient subgroup with the worst prognosis.
26123663 LIN28B as an important effector of the MYCN oncogenic phenotype and underline the importance of MYCN-regulated miRNAs in establishing the MYCN-driven oncogenic process.
26080928 A functional link between Lin28B and the uridylation pathway with a focus on let-7 metabolism in cancer cells.
26071398 The data implicate Lin28B as a novel oncogene in melanomagenesis by mediating a miRNA regulatory circuit.
26028027 Lin28B/let-7 pathway is tightly regulated by macroH2A1
25925570 The study establishes that the ribonuclease DIS3, targeting LIN28B, sustains the maturation of let-7 miRNAs.
25858147 Lin28B(high)-Let7(low) expression pattern was highly correlated with high levels of ARID3B, HMGA2, OCT4, and SOX2 expression in OSCC specimens. Results show how Lin28B/Let7 regulates key cancer stem-like properties in oral squamous cancers.
25726847 Compared with NCMT samples from the same OSCC patient, the expression of Lin28B was increased in all of the tumor samples. A similar upregulation of Lin28B was also observed in LN metastatic when compared with local tumors.
25655194 Upregulation of LIN28B is associated with systemic mastocytosis.
25638158 Data implicate LIN28/RAS/MAP kinase as key drivers of tumorigenesis atypical teratoid rhabdoid tumors.
25503985 rs221236 located at Lin28B may contribute to the risk of oral cavity cancer through the interruption of miRNA binding.
25360631 LIN28B overexpression correlated with reduced patient survival and an increased likelihood of tumour recurrence.LIN28B overexpression contributes to colon tumourigenesis.
25301052 Lin28A and Lin28B enhance, whereas let-7 suppresses, aerobic glycolysis via targeting pyruvate dehydrogenase kinase 1, or PDK1.
25201220 These observations suggest that Lin28B:miR-212 may work as a regulatory loop in androgen-independent prostate cancer
25200669 LIN28 and its regulatory microRNAs have roles in adult adrenocortical cancer
25197381 Our findings point to the prognostic role of Lin28B in gastric adenocarcinoma
25117712 Human LIN28B overexpression is sufficient to initiate hepatoblastoma and hepatocellular carcinoma in murine models.
25010285 Interaction of HIV-1 Gag with lin-28 homolog B (LIN28B) is identified in a series of six affinity purification/mass spectrometry screens
24942926 Expression of SUMO1/2/3 is dramatically enhanced by interferons through an miRNA-based mechanism involving the Lin28/let-7.
24885919 Overexpression of Lin28B was linked to poor differentiation, advanced-stage disease, and Ki67-positive status (all p<0.05). Lin28B expression was significantly different among breast cancer subtypes.
24780874 Genetic variants of LIN28B may be biomarkers for susceptibility to severe radiation pneumonitis in non-small cell lung cancer patients.
24732380 demonstrate overexpression of the LIN28B paralog in a significant percentage of human Wilms tumor
24602972 Consistent with the let-7 microRNA stimulatory role of TRIM71 via Lin28B polyubiquitination.
24498170 reciprocal changes in the expression profiles of the gene encoding the RNA-binding protein, LIN28B, and the related miRNAs, Let-7a, mir-132 and mir-145, in early stages of human placentation
24386298 Lin28B is a novel marker for predicting prognosis in patients with oral squamous cell carcinoma
24244607 Lin28B is an oncofetal circulating cancer stem cell-like marker associated with recurrence of hepatocellular carcinoma.
24056962 miR-26a directly targets Lin28B and Zcchc11-two critical repressors of let-7 maturation.
23798711 LIN28B expression regulates HbF levels and causes adult human erythroblasts to differentiate with a more fetal-like phenotype
23740805 These data confirm the strongest gene reported in Europeans (LIN28B) as a contributor to age of menarche in an Asian population.
23639551 MYCN/LIN28B/Let-7/HMGA2 pathway implicated by meta-analysis of GWAS in suppression of post-natal proliferation thereby potentially contributing to aging
23494474 The oncoprotein HBXIP upregulates Lin28B via activating TF II D to promote proliferation of breast cancer cells.
23482325 Report role of Lin28b/IGF signaling pathway in the progression of head and neck neoplasms.
23378032 Embryonic overexpression of let-7, a microRNA negatively regulated by Lin28a, reduces the germ cell pool, corroborating the role of the Lin28a/let-7 axis in regulating the germ lineage.
23318446 Lin28A/Lin28B serves as key driver genes in Hepatitis B virus X protein-induced hepatocarcinogenesis
23152804 Genetic variants near the puberty-associated gene LIN28B associate with adult weight and body shape in females, suggesting that the gene may tag molecular pathways influencing adult adiposity-related traits.
23063642 Data indicate that full length Lin28B is required to bind efficiently to pre-let-7g.
23052130 We find that LIN28B rs314277 is associated with significant recurrence of colorectal cancer in Stage II disease.
23042116 LIN28B signaled through repression of the let-7 miRNAs and consequently resulted in elevated MYCN protein expression in neuroblastoma cells.
22976955 Rpl22 inactivation promotes neoplastic transformation by inducing expression of Lin28B
22964795 Although LIN28B SNPs were associated with normal pubertal timing, rare variations in this gene do not seem to be commonly involved in the molecular pathogenesis of CPP.
22941191 common variants in HACE1 and LIN28B influence neuroblastoma susceptibility and indicate that both genes likely have a role in disease progression.
22822098 High lin-28B expression is associated with epithelial ovarian cancer.
22433967 High expression of Lin28B correlated significantly with lymph node metastasis and poor prognosis. High expression of Lin28B expression correlated significantly with low expression of let-7.
22263265 Both HeLaS3/pAAV2neo-Lin28a and HeLaS3/pAAV2neo-Lin28b could express Lin28a and Lin28b effectively.
22118463 Unlike Lin28A, Lin28B represses let-7 processing through a Zcchc11-independent mechanism; Lin28B functions in the nucleus by sequestering primary let-7 transcripts and inhibiting their processing by the Microprocessor.
21625210 findings establish a new role for LIN28B in human colon cancer pathogenesis, and suggest LIN28B post-transcriptionally regulates LGR5 and PROM1 through a let-7-independent mechanism
21533284 reported interaction between LIN28B and Let-7 was recapitulated by siRNA knockdown in ovarian cancer cell lines
21512136 findings point to a function for LIN28B in promoting colon tumor pathogenesis, especially metastasis.
20962026 A common genetic variant in LIN28B that confers earlier puberty was associated with a prolonged increase in BMI during adolescence and early to mid-adulthood in women only.
20962026 Observational study of gene-disease association. (HuGE Navigator)
20846217 Observational study of gene-disease association. (HuGE Navigator)
20827722 MicroRNA-125b exerts tumor-suppressive effects in hepatic carcinogenesis through the suppression of oncogene LIN28B expression.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20525879 High Lin-28B expression promotes transformation and invasion in human hepatocellular carcinoma.
20398887 Distinct variants at LIN28B influence growth in height from birth to adulthood.
20398887 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20350940 Lack of any variation in the coding region of the gene suggests that LIN28B in developmental timing is so crucial that any changes in the conserved protein would probably be lethal
20350940 Observational study of gene-disease association. (HuGE Navigator)
20303062 A variant in LIN28B is associated with 2D:4D finger-length ratio, a putative retrospective biomarker of prenatal testosterone exposure.
20303062 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19745602 LIN28B plays an important role in radiation responses of lung cancer cells through inhibiting let-7g microRNA processing and increasing translation of KRAS.
19495417 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b
19483683 Study shows that LIN28 and LIN28B are overexpressed in primary human tumors and human cancer cell lines (overall frequency approximately 15%), and that overexpression is linked to repression of let-7 family miRNAs and derepression of let-7 targets.
19448623 Variation in LIN28B, a potent and specific regulator of microRNA processing is the first genetic determinant regulating the timing of human pubertal growth and development.
19448622 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19448621 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
19211792 highlight an important role for Lin-28B in Myc-driven cellular phenotypes
16971064 These findings strongly implicate a critical role of LIN28B during development and tumorigenesis and suggest a possible novel mechanism.

AA Sequence

MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLF      1 - 70
MEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPKGDRCYNCGGLDHHAK     71 - 140
ECSLPPQPKKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQEA    141 - 210
RAEISERSGRSPQEASSTKSSIAPEEQSKKGPSVQKRKKT                                  211 - 250
//

Text Mined References (92)

PMID Year Title
27383785 2016 Multiple mechanisms disrupt the let-7 microRNA family in neuroblastoma.
26751131 2016 LIN-28B/let-7a/IGF-II axis molecular subtypes are associated with epithelial ovarian cancer prognosis.
26712910 2016 LIN28B overexpression defines a novel fetal-like subgroup of juvenile myelomonocytic leukemia.
26481147 2015 A LIN28B-RAN-AURKA Signaling Network Promotes Neuroblastoma Tumorigenesis.
26158423 2015 Overexpression of the RNA-binding proteins Lin28B and IGF2BP3 (IMP3) is associated with chemoresistance and poor disease outcome in ovarian cancer.
26123663 2015 MYCN-driven regulatory mechanisms controlling LIN28B in neuroblastoma.
26080928 2015 A role of uridylation pathway for blockade of let-7 microRNA biogenesis by Lin28B.
26071398 2015 Lin28B promotes melanoma growth by mediating a microRNA regulatory circuit.
26028027 2016 MacroH2A1 downregulation enhances the stem-like properties of bladder cancer cells by transactivation of Lin28B.
25925570 2015 The ribonuclease DIS3 promotes let-7 miRNA maturation by degrading the pluripotency factor LIN28B mRNA.
25858147 2015 Lin28B/Let-7 Regulates Expression of Oct4 and Sox2 and Reprograms Oral Squamous Cell Carcinoma Cells to a Stem-like State.
25726847 2015 Elevated Lin28B expression is correlated with lymph node metastasis in oral squamous cell carcinomas.
25655194 2015 The role of Lin28b in myeloid and mast cell differentiation and mast cell malignancy.
25638158 2015 Disrupting LIN28 in atypical teratoid rhabdoid tumors reveals the importance of the mitogen activated protein kinase pathway as a therapeutic target.
25503985 2014 Genetic variants in let-7/Lin28 modulate the risk of oral cavity cancer in a Chinese Han population.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25360631 2014 LIN28B promotes colon cancer migration and recurrence.
25301052 2014 Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25201220 2014 A potential regulatory loop between Lin28B:miR?212 in androgen-independent prostate cancer.
25200669 2015 Expression of LIN28 and its regulatory microRNAs in adult adrenocortical cancer.
25197381 2014 Lin28B is a novel prognostic marker in gastric adenocarcinoma.
25117712 2014 Lin28b is sufficient to drive liver cancer and necessary for its maintenance in murine models.
24942926 2014 Interferon controls SUMO availability via the Lin28 and let-7 axis to impede virus replication.
24885919 2014 Lin28B expression correlates with aggressive clinicopathological characteristics in breast invasive ductal carcinoma.
24780874 2014 Genetic variants of the LIN28B gene predict severe radiation pneumonitis in patients with non-small cell lung cancer treated with definitive radiation therapy.
24770850 2014 Genome-wide association study of sexual maturation in males and females highlights a role for body mass and menarche loci in male puberty.
24732380 2014 Lin28 sustains early renal progenitors and induces Wilms tumor.
24602972 2014 The ubiquitin ligase human TRIM71 regulates let-7 microRNA biogenesis via modulation of Lin28B protein.
24498170 2014 The Lin28/Let-7 system in early human embryonic tissue and ectopic pregnancy.
24386298 2013 Increased expression of Lin28B associates with poor prognosis in patients with oral squamous cell carcinoma.
24244607 2013 Lin28B is an oncofetal circulating cancer stem cell-like marker associated with recurrence of hepatocellular carcinoma.
24056962 2014 miR-26a enhances miRNA biogenesis by targeting Lin28B and Zcchc11 to suppress tumor growth and metastasis.
23798711 2013 LIN28B-mediated expression of fetal hemoglobin and production of fetal-like erythrocytes from adult human erythroblasts ex vivo.
23740805 2013 Replication of LIN28B SNP association with age of menarche in young Filipino women.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
23639551 MYCN/LIN28B/Let-7/HMGA2 pathway implicated by meta-analysis of GWAS in suppression of post-natal proliferation thereby potentially contributing to aging.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23494474 2013 The oncoprotein HBXIP upregulates Lin28B via activating TF II D to promote proliferation of breast cancer cells.
23482325 2012 Lin28b promotes head and neck cancer progression via modulation of the insulin-like growth factor survival pathway.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23378032 2013 Lin28a regulates germ cell pool size and fertility.
23318446 2014 Hepatitis B virus X protein upregulates Lin28A/Lin28B through Sp-1/c-Myc to enhance the proliferation of hepatoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152804 2012 Association of LIN28B with adult adiposity-related traits in females.
23063642 2012 Recognition of the let-7g miRNA precursor by human Lin28B.
23052130 2012 A LIN28B polymorphism predicts for colon cancer survival.
23042116 2012 LIN28B induces neuroblastoma and enhances MYCN levels via let-7 suppression.
22976955 2012 Inactivation of ribosomal protein L22 promotes transformation by induction of the stemness factor, Lin28B.
22964795 2012 Absence of functional LIN28B mutations in a large cohort of patients with idiopathic central precocious puberty.
22941191 2012 Common variation at 6q16 within HACE1 and LIN28B influences susceptibility to neuroblastoma.
22822098 2012 Functional study of risk loci of stem cell-associated gene lin-28B and associations with disease survival outcomes in epithelial ovarian cancer.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22570413 2012 The Lin28 cold-shock domain remodels pre-let-7 microRNA.
22433967 2012 High expression of Lin28 is associated with tumour aggressiveness and poor prognosis of patients in oesophagus cancer.
22263265 2011 [Effects of Lin28a and Lin28b on let-7 family activity].
22118463 2011 Lin28A and Lin28B inhibit let-7 microRNA biogenesis by distinct mechanisms.
21625210 2011 LIN28B fosters colon cancer migration, invasion and transformation through let-7-dependent and -independent mechanisms.
21533284 2011 Deregulation of MYCN, LIN28B and LET7 in a molecular subtype of aggressive high-grade serous ovarian cancers.
21512136 2011 LIN28B promotes colon cancer progression and metastasis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20962026 2011 Associations between the pubertal timing-related variant in LIN28B and BMI vary across the life course.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20827722 2010 MicroRNA-125b suppressesed human liver cancer cell proliferation and metastasis by directly targeting oncogene LIN28B2.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20525879 2010 Lin-28B expression promotes transformation and invasion in human hepatocellular carcinoma.
20398887 2010 Distinct variants at LIN28B influence growth in height from birth to adulthood.
20350940 2010 LIN28B in constitutional delay of growth and puberty.
20303062 2010 A variant in LIN28B is associated with 2D:4D finger-length ratio, a putative retrospective biomarker of prenatal testosterone exposure.
19745602 2009 LIN28B confers radio-resistance through the posttranscriptional control of KRAS.
19703396 2009 TUT4 in concert with Lin28 suppresses microRNA biogenesis through pre-microRNA uridylation.
19495417 2009 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b.
19483683 2009 Lin28 promotes transformation and is associated with advanced human malignancies.
19448623 2009 Genetic variation in LIN28B is associated with the timing of puberty.
19448622 2009 Genome-wide association study identifies sequence variants on 6q21 associated with age at menarche.
19448621 2009 Genome-wide association studies identify loci associated with age at menarche and age at natural menopause.
19448620 2009 Meta-analysis of genome-wide association data identifies two loci influencing age at menarche.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
19211792 2009 Lin-28B transactivation is necessary for Myc-mediated let-7 repression and proliferation.
18951094 2008 Lin28 mediates the terminal uridylation of let-7 precursor MicroRNA.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16971064 2006 Identification and characterization of lin-28 homolog B (LIN28B) in human hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.