Property Summary

NCBI Gene PubMed Count 101
PubMed Score 175.37
PubTator Score 148.63

Knowledge Summary

Patent (6,149)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -3.800 4.5e-06
osteosarcoma -2.042 4.1e-06
atypical teratoid/rhabdoid tumor -1.200 3.7e-05
medulloblastoma, large-cell -1.300 9.4e-05
adult high grade glioma -1.300 1.4e-03
posterior fossa group B ependymoma -1.100 1.5e-05
lung adenocarcinoma 1.900 4.5e-14
COPD -1.200 1.1e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (77)

PMID Text
25981171 This study showed that LIMK1 messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples.
25884247 Gene knockdown/rescue experiments reveal that LIMK1 palmitoylation is essential for normal spine actin polymerization, for spine-specific structural plasticity and for long-term spine stability.
25661344 LIMK1 is overexpressed in gastric cancer.
25529997 LIMK1 is overexpressed in endometrial stromal cells.
25359780 CXCL12/CXCR4 signaling has a role in docetaxel-induced microtubule stabilization via p21-activated kinase 4-dependent activation of LIMK1
25344584 Results show that in addition to a potential role in promoting metastasis, changes in LIMK1 and LIMK2 expression and/or activity might contribute to AR function in prostate cancer via regulation of microtubule cytoskeletal dynamics.
25307528 LIMK1 has a role in regulating human trophoblast invasion/differentiation and is down-regulated in preeclampsia
25190487 Data show that the downregulation of miR-138 induced the upregulation of Limk1 in ovarian cancer (OC) cells suggesting that these 2 genes may play a key role in the migration and invasion of OC cells.
25107909 the functional relevance of the LRAP25-MRCK complex in LIMK1-cofilin signaling and the importance of LRAP adaptors as key determinants of MRCK cellular localization and downstream specificities.
25019203 miR-20a is involved in the tumor inhibition of cutaneous squamous cell carcinoma by directly targeting LIMK1 gene.
24858712 miR-20a plays a role as a tumor suppressor in thyroid cancer cells and targets LIMK1
24778234 CCR5 expression inhibits HIV-1 gp120-induced LIMK1 activation and cofilin phosphorylation in CD4/CXCR4 expressing 293T cells
24696479 ROCK1- and LIMK1-regulated phosphorylation of cofilin played a role in retrovirus release from host cells and in cell-cell transmission events.
24390089 Ectopic expression of LIMK1 dramatically dampened mir-27b action of cancer inhibition.
24063279 These results indicate that the overexpression of LIMK1 is tightly associated with an aggressive phenotype of lung cancer cells, knockdown of LIMK1 suppressed cell migration and invasion, enhanced chemosensitivity, suggesting a potential therapeutic target for lung cancer.
24039253 Thus this study provides evidence for a novel role of LIMK1 and SSH-1L in selectively regulating endothelial cell inflammation associated with intravascular coagulation.
23702034 DAPK functions as a scaffold for the LIMK/cofilin complex and triggers a closer interaction of both proteins under TNF stimulation.
23700283 the conserved region in the LIMK1 3' UTR is involved in regulating LIMK1 expression at the post-transcriptional level
23620575 LIMK1 plays a novel role in selectively mediating GPIb-IX-dependent TXA2 synthesis and thrombosis.
23338717 Overexpression of LIMK1 is associated with the development and progression of glioblastoma multiforme.
23294842 CCR5 expression inhibits HIV-1 gp120-induced LIMK1 activation and cofilin phosphorylation in CD4/CXCR4 expressing 293T cells
23239465 Overexpression of LIMK1 is associated with breast cancer growth and invasiveness.
23167938 The authors believe that the Williams-Beuren syndrome chromosome region can be a possible target for further investigation as the genetic basis of keratoconus.
23086941 BDNF-induced TrkB dimerization led to LIMK1 dimerization and transphosphorylation independent of TrkB kinase activity, which could further enhance the activation and stabilization of LIMK1
22906279 LIMK1 is associated with the development of ovarian cancer and with the level of tumour differentiation in patients with ovarian carcinoma.
22883572 A novel activity of Rho in promoting a complex between fascin-1 and LIMK1/2 that modulates the interaction of fascin-1 with actin, was identified.
22715593 demonstrated that LIMK1, a key regulator of actin cytoskeleton, was overexpressed at both mRNA and protein levels in MG63/VCR cells and the higher LIMK1 protein level was correlated with higher level of phosphorylated cofilin
22632162 CCR5 expression inhibits HIV-1 gp120-induced LIMK1 activation and cofilin phosphorylation in CD4/CXCR4 expressing 293T cells
22214762 Aur-A physically associates with LIMK1 and activates it through phosphorylation, which is important for its centrosomal and spindle pole localization.
21923909 Data describe the role of LIMK1-mediated CFL1 pathway and actin dynamics in retinoid receptor mediated function and show that LIMK1-mediated phosphocycling of CFL1 plays a role in maintaining actin homeostasis and receptor activity.
21923909 CCR5 expression inhibits HIV-1 gp120-induced LIMK1 activation and cofilin phosphorylation in CD4/CXCR4 expressing 293T cells
21868383 LIMK1 has a dual role in regulating lamellipodium extension by decelerating actin retrograde flow and polymerization.
21682918 LIMK1 activity in both the cytoplasmic and nuclear compartments promotes breast cancer progression.
21321123 LIM kinase 1 modulates cortical actin and CXCR4 cycling and is activated by HIV-1 to initiate viral infection.
21321123 CCR5 expression inhibits HIV-1 gp120-induced LIMK1 activation and cofilin phosphorylation in CD4/CXCR4 expressing 293T cells
21228795 evealed a SNP, rs6460071 located on LIMK1 gene (P = 0.00069) to be significantly associated with increased risk of intracranial aneurysm
21219645 LIM kinase1 modulates function of membrane type matrix metalloproteinase 1 in prostate cancer cells
20873970 Changes in the expression of cytoskeletal regulatory proteins such as LIMK and cofilin may play a role in weakening thoracic aortic medial tissue, as a precondition to thoracic aortic dissection.
20694560 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20622363 High LIMK1 is associated with cervical cancer dysplasia.
20347121 FXa induced myosin light chain phosphorylation and LIMK1 activation resulting in cofilin inactivation
20100465 LIMK1 mediates both the mesenchymal and amoeboid modes of invasion of HT1080 cells.
20061392 phosphorylation of annexin 1 regulates the angiogenic effect that is associated with the activation of the p38/LIM kinase 1 axis by VEGF
20047470 Both LIMK1 and LIMK2 single knock down led to a reduction of invasion and metastatic behavior in the zebrafish xenograft metastasis assay.
20041213 CCR5 expression inhibits HIV-1 gp120-induced LIMK1 activation and cofilin phosphorylation in CD4/CXCR4 expressing 293T cells
19778628 DGCR6L, a novel PAK4 interacting protein, regulated PAK4-mediated migration of human gastric cancer cells via LIMK1.
19734939 the p57(Kip2) control of LIMK-1 ultimately affects cell mobility negatively.
19662944 findings indicate that spatial deficits associated with Williams Syndrome also affect large-scale spatial processing and suggest that hemizygous deletion of LIMK1 is not sufficient to account for any of the spatial deficits associated with this syndrome.
19056482 Observational study of gene-disease association. (HuGE Navigator)
18978953 LIMK1 may mediate TGF-beta-dependent signaling during ocular inflammation.
18566305 Observational study of gene-disease association. (HuGE Navigator)
18424072 These results support a model whereby hepatocyte growth factor-stimulated cell migration also requires a cofilin phosphorylation step that is mediated by PAK4.
18096821 PDGF participates in actin dynamics by dual regulation of cofilin activity via LIMK and SSH1L in aortic smooth muscle cells
18079118 LIMK1-mediated cofilin phosphorylation is required for accurate spindle orientation by stabilizing cortical actin networks during mitosis.
18028908 LIMK1 phosphorylation of p25 blocks p25 activity, thus promoting microtubule disassembly.
18000399 gamma-tubulin associates with phosphorylated LIMK1 and LIMK2 but not with dephosphorylated LIMK1 or LIMK2.
17572668 CCR5 expression inhibits HIV-1 gp120-induced LIMK1 activation and cofilin phosphorylation in CD4/CXCR4 expressing 293T cells
17512523 These findings demonstrate a cell-type dependent functional interaction between parkin and LIMK1 and provide new evidence that links parkin and LIMK1 in the pathogenesis of familial PD.
17294230 the structure, regulation and function; possible contributions to human disease (Review)
17287949 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16763828 Taken together, our novel findings presented in this paper implicate that LIMK1 signaling indeed plays a pivotal role in the regulation of EGFR trafficking through the endocytic pathway in invasive tumor cells.
16611674 Observational study of gene-disease association. (HuGE Navigator)
16611674 Elastin and LIMK1 SNPs effect in the at-risk haplotype possibly by weakening the vascular wall and promoting the development of IA
16455074 LIMK1 may play a role different from that of LIMK2 in regulating mitotic spindle organization, chromosome segregation, and cytokinesis during the cell division cycle.
16381000 results suggested an important role for LIMK1 signaling in breast cancer tumor growth, angiogenesis and invasion and a regulatory connection between LIMK1 and the uPA system
16204183 Rnf6 controls cellular LIMK1 concentrations and indicate a new function for the ubiquitin/proteasome system in regulating local growth cone actin dynamics
15897190 LIMK1 activity is required for thrombin-induced modulation of microtubule destabilization and actin polymerization
15660133 a multi-protein complex consisting of SSH-1L, LIMK1, actin, and the scaffolding protein, 14-3-3zeta, is involved, along with the kinase, PAK4, in the regulation of ADF/cofilin activity
15220930 LATS1 is a novel cytoskeleton regulator that affects cytokinesis by regulating actin polymerization through negative modulation of LIMK1.
15189451 LIMK1 is cleaved and activated during antiFas antibody-induced apoptosis. Expression of an N-terminally truncated LMK1 fragment induced membrane blebbing.
15023529 LIMK1 is enriched in both axonal and dendritic growth cones of E18 hippocampal pyramidal neurons where it is found in punctae that extend far out into filopodia, as well as in a perinuclear region identified as Golgi.
14530263 LIM-kinase 1 is translocated to the nucleus after being bound by p57kip2
12821664 LIMK1 has a role in regulating cell division and invasive property of prostate cancer cells; the effect is not mediated by phosphorylation of cofilin
12777619 LIM kinase 1 (LIMK1), a critical regulator of actin dynamics, plays a regulatory role in tumor cell invasion.
12323073 identification as interaction partner of 14-3-3 zeta
11925442 Mitosis-specific activation of LIM motif-containing protein kinase and roles of cofilin phosphorylation and dephosphorylation in mitosis.

AA Sequence

MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQL      1 - 70
FCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQ     71 - 140
TVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMS    141 - 210
PDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTP    211 - 280
SGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCF    281 - 350
GQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT    351 - 420
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKT    421 - 490
QPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFG    491 - 560
LNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWE    561 - 630
TYRRGESGLPAHPEVPD                                                         631 - 647
//

Text Mined References (114)

PMID Year Title
25981171 2015 Altered expression of CDC42 signaling pathway components in cortical layer 3 pyramidal cells in schizophrenia.
25884247 2015 Palmitoylation of LIM Kinase-1 ensures spine-specific actin polymerization and morphological plasticity.
25661344 2015 Overexpression of LIMK1 promotes tumor growth and metastasis in gastric cancer.
25529997 2015 Effect of LIM kinase 1 overexpression on behaviour of endometriosis-derived stromal cells.
25359780 2014 CXCL12/CXCR4 signaling counteracts docetaxel-induced microtubule stabilization via p21-activated kinase 4-dependent activation of LIM domain kinase 1.
25344584 2015 Elevated LIM kinase 1 in nonmetastatic prostate cancer reflects its role in facilitating androgen receptor nuclear translocation.
25307528 2014 LIMK1 regulates human trophoblast invasion/differentiation and is down-regulated in preeclampsia.
25190487 2014 Upregulation of Limk1 caused by microRNA-138 loss aggravates the metastasis of ovarian cancer by activation of Limk1/cofilin signaling.
25107909 2014 Adaptor protein LRAP25 mediates myotonic dystrophy kinase-related Cdc42-binding kinase (MRCK) regulation of LIMK1 protein in lamellipodial F-actin dynamics.
25019203 2014 MiR-20a inhibits cutaneous squamous cell carcinoma metastasis and proliferation by directly targeting LIMK1.
24858712 2014 MiR-20a is upregulated in anaplastic thyroid cancer and targets LIMK1.
24696479 2014 ROCK1 and LIM kinase modulate retrovirus particle release and cell-cell transmission events.
24390089 2014 MiR-27b targets LIMK1 to inhibit growth and invasion of NSCLC cells.
24063279 2013 Downregulation of LIMK1 level inhibits migration of lung cancer cells and enhances sensitivity to chemotherapy drugs.
24039253 2013 Thrombin selectively engages LIM kinase 1 and slingshot-1L phosphatase to regulate NF-?B activation and endothelial cell inflammation.
23702034 2013 Identification of DAPK as a scaffold protein for the LIMK/cofilin complex in TNF-induced apoptosis.
23700283 2013 A conserved region in the 3' untranslated region of the human LIMK1 gene is critical for proper expression of LIMK1 at the post-transcriptional level.
23633677 2013 ?-arrestin-dependent activation of the cofilin pathway is required for the scavenging activity of the atypical chemokine receptor D6.
23620575 2013 LIM kinase-1 selectively promotes glycoprotein Ib-IX-mediated TXA2 synthesis, platelet activation, and thrombosis.
23338717 2013 Correlation between Rho-kinase pathway gene expressions and development and progression of glioblastoma multiforme.
23239465 2013 LIM kinase inhibition reduces breast cancer growth and invasiveness but systemic inhibition does not reduce metastasis in mice.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23167938 2013 A new case of keratoconus associated with Williams-Beuren syndrome.
23086941 2012 LIM kinase 1 (LIMK1) interacts with tropomyosin-related kinase B (TrkB) and Mediates brain-derived neurotrophic factor (BDNF)-induced axonal elongation.
22906279 2012 Immunohistochemical investigation of the correlation between LIM kinase 1 expression and development and progression of human ovarian carcinoma.
22886629 2012 LIM kinases are attractive targets with many macromolecular partners and only a few small molecule regulators.
22883572 2012 A novel Rho-dependent pathway that drives interaction of fascin-1 with p-Lin-11/Isl-1/Mec-3 kinase (LIMK) 1/2 to promote fascin-1/actin binding and filopodia stability.
22715593 2011 Overexpression of LIMK1 promotes migration ability of multidrug-resistant osteosarcoma cells.
22214762 2012 A functional cooperativity between Aurora A kinase and LIM kinase1: implication in the mitotic process.
21923909 2011 LIM kinase 1 - dependent cofilin 1 pathway and actin dynamics mediate nuclear retinoid receptor function in T lymphocytes.
21868383 2011 LIM kinase has a dual role in regulating lamellipodium extension by decelerating the rate of actin retrograde flow and the rate of actin polymerization.
21682918 2011 Nuclear and cytoplasmic LIMK1 enhances human breast cancer progression.
21321123 2011 LIM kinase 1 modulates cortical actin and CXCR4 cycling and is activated by HIV-1 to initiate viral infection.
21228795 2011 Impact of LIMK1, MMP2 and TNF-? variations for intracranial aneurysm in Japanese population.
21219645 2011 LIM kinase1 modulates function of membrane type matrix metalloproteinase 1: implication in invasion of prostate cancer cells.
20873970 2010 A study of the expression and interaction of Destrin, cofilin, and LIMK in Debakey I type thoracic aortic dissection tissue.
20694560 2011 Common genetic polymorphisms in moyamoya and atherosclerotic disease in Europeans.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20622363 Expression profiling of G2/M phase regulatory proteins in normal, premalignant and malignant uterine cervix and their correlation with survival of patients.
20347121 2010 Coagulation Factor Xa inhibits cancer cell migration via LIMK1-mediated cofilin inactivation.
20100465 2010 LIM-kinase is critical for the mesenchymal-to-amoeboid cell morphological transition in 3D matrices.
20061392 2010 Regulation of vascular endothelial growth factor-induced endothelial cell migration by LIM kinase 1-mediated phosphorylation of annexin 1.
20047470 2009 LIMK1 and LIMK2 are important for metastatic behavior and tumor cell-induced angiogenesis of pancreatic cancer cells.
19778628 2010 DGCR6L, a novel PAK4 interaction protein, regulates PAK4-mediated migration of human gastric cancer cell via LIMK1.
19734939 2009 The Cdk inhibitor p57(Kip2) controls LIM-kinase 1 activity and regulates actin cytoskeleton dynamics.
19662944 2009 Inefficient search of large-scale space in Williams syndrome: further insights on the role of LIMK1 deletion in deficits of spatial cognition.
19424295 2009 Regulation of actin function by protein kinase A-mediated phosphorylation of Limk1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18978953 2008 Downregulation of LIM kinase 1 suppresses ocular inflammation and fibrosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18566305 2008 Genetic factors for ischemic and hemorrhagic stroke in Japanese individuals.
18424072 2008 A PAK4-LIMK1 pathway drives prostate cancer cell migration downstream of HGF.
18096821 2008 Dual regulation of cofilin activity by LIM kinase and Slingshot-1L phosphatase controls platelet-derived growth factor-induced migration of human aortic smooth muscle cells.
18079118 2008 LIM kinase-mediated cofilin phosphorylation during mitosis is required for precise spindle positioning.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18028908 2007 The phosphorylation of p25/TPPP by LIM kinase 1 inhibits its ability to assemble microtubules.
18000399 2007 Phosphorylated LIM kinases colocalize with gamma-tubulin in centrosomes during early stages of mitosis.
17853892 2007 Direct stimulation of receptor-controlled phospholipase D1 by phospho-cofilin.
17512523 2007 Parkin interacts with LIM Kinase 1 and reduces its cofilin-phosphorylation activity via ubiquitination.
17500066 2007 Beta-arrestin-dependent regulation of the cofilin pathway downstream of protease-activated receptor-2.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17294230 2007 LIM kinases: function, regulation and association with human disease.
17287949 2007 Systematic screening of lysyl oxidase-like (LOXL) family genes demonstrates that LOXL2 is a susceptibility gene to intracranial aneurysms.
17188549 2007 Lim kinases, regulators of actin dynamics.
16837009 2006 A dimeric kinase assembly underlying autophosphorylation in the p21 activated kinases.
16763828 2006 A role of LIM kinase 1/cofilin pathway in regulating endocytic trafficking of EGF receptor in human breast cancer cells.
16641196 2006 Hsp90 increases LIM kinase activity by promoting its homo-dimerization.
16611674 2006 A haplotype spanning two genes, ELN and LIMK1, decreases their transcripts and confers susceptibility to intracranial aneurysms.
16456544 2006 MAPKAPK-2-mediated LIM-kinase activation is critical for VEGF-induced actin remodeling and cell migration.
16455074 2006 Different activity regulation and subcellular localization of LIMK1 and LIMK2 during cell cycle transition.
16381000 2006 LIM kinase 1 increases tumor metastasis of human breast cancer cells via regulation of the urokinase-type plasminogen activator system.
16230460 2005 Spatial and temporal regulation of cofilin activity by LIM kinase and Slingshot is critical for directional cell migration.
16204183 2005 The ubiquitin ligase Rnf6 regulates local LIM kinase 1 levels in axonal growth cones.
16192283 2005 Single molecule recognition between cytochrome C 551 and gold-immobilized azurin by force spectroscopy.
15897190 2005 LIM kinase 1 coordinates microtubule stability and actin polymerization in human endothelial cells.
15660133 2005 Interplay between components of a novel LIM kinase-slingshot phosphatase complex regulates cofilin.
15220930 2004 LATS1 tumour suppressor affects cytokinesis by inhibiting LIMK1.
15189451 2004 Caspase-mediated cleavage and activation of LIM-kinase 1 and its role in apoptotic membrane blebbing.
15023529 2004 LIM kinase 1, a key regulator of actin dynamics, is widely expressed in embryonic and adult tissues.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14530263 2003 p57Kip2 regulates actin dynamics by binding and translocating LIM-kinase 1 to the nucleus.
12963706 2003 Direct signaling by the BMP type II receptor via the cytoskeletal regulator LIMK1.
12853948 2003 The DNA sequence of human chromosome 7.
12821664 2003 LIM kinase 1 is essential for the invasive growth of prostate epithelial cells: implications in prostate cancer.
12807904 2003 Cell cycle-associated changes in Slingshot phosphatase activity and roles in cytokinesis in animal cells.
12777619 2003 A role for LIM kinase in cancer invasion.
12684437 2003 Control of growth cone motility and morphology by LIM kinase and Slingshot via phosphorylation and dephosphorylation of cofilin.
12361576 2002 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin.
12323073 2003 Identification of cofilin and LIM-domain-containing protein kinase 1 as novel interaction partners of 14-3-3 zeta.
11925442 2002 Mitosis-specific activation of LIM motif-containing protein kinase and roles of cofilin phosphorylation and dephosphorylation in mitosis.
11832213 2002 Control of actin reorganization by Slingshot, a family of phosphatases that dephosphorylate ADF/cofilin.
11418599 2001 Cofilin phosphorylation and actin reorganization activities of testicular protein kinase 2 and its predominant expression in testicular Sertoli cells.
11413130 2001 Cytoskeletal changes regulated by the PAK4 serine/threonine kinase are mediated by LIM kinase 1 and cofilin.
11340065 2001 Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha.
11003705 2000 Comparative genomic sequence analysis of the Williams syndrome region (LIMK1-RFC2) of human chromosome 7q11.23.
10652353 2000 Rho-associated kinase ROCK activates LIM-kinase 1 by phosphorylation at threonine 508 within the activation loop.
10559936 1999 Activation of LIM-kinase by Pak1 couples Rac/Cdc42 GTPase signalling to actin cytoskeletal dynamics.
10436159 1999 Signaling from Rho to the actin cytoskeleton through protein kinases ROCK and LIM-kinase.
10431247 1999 RLIM inhibits functional activity of LIM homeodomain transcription factors via recruitment of the histone deacetylase complex.
10428028 1999 Signal-regulated activation of serum response factor is mediated by changes in actin dynamics.
10196227 1999 Structural features of LIM kinase that control effects on the actin cytoskeleton.
9685409 1998 Transmembrane neuregulins interact with LIM kinase 1, a cytoplasmic protein kinase implicated in development of visuospatial cognition.
9655398 1998 Cofilin phosphorylation by LIM-kinase 1 and its role in Rac-mediated actin reorganization.
8980133 1996 Self-association of LIM-kinase 1 mediated by the interaction between an N-terminal LIM domain and a C-terminal kinase domain.
8824278 1996 Dephosphorylation of serine 3 regulates nuclear translocation of cofilin.
8812460 1996 Identification of genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients.
8689688 1996 LIM-kinase1 hemizygosity implicated in impaired visuospatial constructive cognition.
8673124 1996 LIM-kinase deleted in Williams syndrome.
8537403 1995 Identification and characterization of a novel family of serine/threonine kinases containing two N-terminal LIM motifs.
8183554 1994 Identification of a human cDNA encoding a novel protein kinase with two repeats of the LIM/double zinc finger motif.