Property Summary

NCBI Gene PubMed Count 13
PubMed Score 658.38
PubTator Score 31.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
HYPERGLYCINEMIA, LACTIC ACIDOSIS, AND SEIZURES 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.0e-06
interstitial cystitis 2312 1.8e-03
Disease Target Count Z-score Confidence
Disease of mental health 36 0.0 1.3
Disease Target Count Z-score Confidence
Leigh disease 100 0.0 5.0

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.200 1.8e-03
ovarian cancer -1.400 2.0e-06

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MSLRCGDAARTLGPRVFGRYFCSPVRPLSSLPDKKKELLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQK      1 - 70
GERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRG     71 - 140
CRFCSVKTARNPPPLDASEPYNTAKAIAEWGLDYVVLTSVDRDDMPDGGAEHIAKTVSYLKERNPKILVE    141 - 210
CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQSKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIML    211 - 280
GLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVR    281 - 350
SSYKAGEFFLKNLVAKRKTKDL                                                    351 - 372
//

Text Mined References (15)

PMID Year Title