Property Summary

NCBI Gene PubMed Count 19
PubMed Score 91.76
PubTator Score 114.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 169 0.0 0.0
Disease Target Count
Rheumatoid arthritis 1156
Disease Target Count P-value
ovarian cancer 8297 3.8e-15
malignant mesothelioma 3135 3.0e-07
nasopharyngeal carcinoma 1024 6.9e-05
psoriasis 6514 1.4e-03
glioblastoma 5635 4.6e-03
astrocytic glioma 2530 9.7e-03
ependymoma 4559 2.2e-02
osteosarcoma 7766 4.2e-02
Disease Target Count Z-score Confidence
Familial hemophagocytic lymphohistiocytosis 2 15 3.55 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -2.700 9.7e-03
ependymoma -3.800 2.2e-02
glioblastoma -1.800 4.6e-03
malignant mesothelioma 5.300 3.0e-07
nasopharyngeal carcinoma 2.700 6.9e-05
osteosarcoma 1.010 4.2e-02
ovarian cancer -5.500 3.8e-15
psoriasis -1.500 1.4e-03

 GWAS Trait (1)

Gene RIF (9)

AA Sequence

MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVD      1 - 70
KQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNC     71 - 140
FTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGAAGANPLG    141 - 210
LPYYNGVGTVQKGRPRKRKSPGPGADLAAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRT    211 - 280
MKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDAALQTGTPSGPA    281 - 350
SELSNASLSPSSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLTNLF                  351 - 406
//

Text Mined References (19)

PMID Year Title