Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.47
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.128 5.9e-06
posterior fossa group A ependymoma -2.800 2.9e-22
glioblastoma -1.700 2.2e-04
atypical teratoid / rhabdoid tumor -2.000 9.6e-07
pediatric high grade glioma -1.400 3.4e-04
pilocytic astrocytoma -1.200 4.2e-05
subependymal giant cell astrocytoma -1.779 2.6e-02
lung carcinoma 1.300 3.2e-32
ovarian cancer -1.500 6.4e-06

Synonym

Accession Q7Z7J7 A6NH76 Q29RV7
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15905332 The authors present an overview of the LHFP gene family in mouse and humans

AA Sequence

MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGL      1 - 70
AGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAWMQLLAALCLV     71 - 140
LGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQTDLLQEELK    141 - 210
PENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP                                     211 - 247
//

Text Mined References (4)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15905332 2005 A missense mutation in the previously undescribed gene Tmhs underlies deafness in hurry-scurry (hscy) mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.