Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.81
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 8.0e-04
Astrocytoma, Pilocytic -1.200 3.8e-05
atypical teratoid / rhabdoid tumor -2.000 9.6e-07
ependymoma -2.600 2.4e-24
glioblastoma -1.200 1.6e-04
lung carcinoma 1.300 3.2e-32
osteosarcoma 1.128 5.9e-06
ovarian cancer -1.500 6.4e-06
subependymal giant cell astrocytoma -1.779 2.6e-02

Gene RIF (2)

AA Sequence

MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGL      1 - 70
AGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAWMQLLAALCLV     71 - 140
LGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQTDLLQEELK    141 - 210
PENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP                                     211 - 247
//

Text Mined References (4)

PMID Year Title