Property Summary

NCBI Gene PubMed Count 202
PubMed Score 355.61
PubTator Score 936.55

Knowledge Summary

Patent (41,582)

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer -2.400 2.3e-08
subependymal giant cell astrocytoma 2.284 3.7e-02
ductal carcinoma in situ -1.200 2.3e-02
psoriasis -1.700 4.1e-21

 GWAS Trait (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1402 confirmatory 0 / 2 / 29 Counterscreen for Agonists of Thyroid Stimulating Hormone Receptor: HTRF Activity in a Luteinizing Hormone Receptor Cell Line
504385 confirmatory 1 / 0 / 6 Counterscreen for antagonists of the thyroid stimulating hormone receptor: ELISA activity in a Luteinizing Hormone Receptor cell line
602293 confirmatory 29 / 125 / 1130 qHTS for antagonists of the Thyroid Stimulation Hormone Receptor: Hit Validation in HTRF Activity in a Luteinizing Hormone Receptor Cell Line

Gene RIF (162)

PMID Text
26831561 Data indicate two patients with peripheral precocious puberty and an activating mutation in the luteinizing hormone (LH))/choriogonadotropin receptor (LHCGR) gene.
26679164 The expression of miR-592 and its effects on LHCG receptors in patients with polycystic ovary syndrome and normal controls are described.
26663062 Data suggest that rs13405728 single nucleotide polymorphism of the luteinizing hormone receptor (LHR) gene may be associated with slow ovarian response in assisted reproductive technology (ART).
26662070 LHbeta G1052A and LHCGR G935A genes polymorphisms are associated with increased risk of polycystic ovary syndrome in Egyptian women especially in obese cases.
26112185 the LHR can act in an invertebrate demonstrates the conservation of factors required for GPCR function among phylogenetically distant organisms.
25935136 The insLQ polymorphism within LHR is associated with endometriosis and infertility.
25916694 Melatonin affects the secretion of GnRH, LH and testosterone, improves sperm quality thereby regulating the testicular development and male reproduction. (Review)
25795638 affected patients were all homozygous for a novel mutation in the LHCGR gene, a deletion of guanine in position 1850 (1850delG);the novel LHCGR mutation leads to complete inactivation of the LHCGR receptor due to trafficking and signaling abnormalities
25676660 LHCGR levels in circulation predicts early and late preeclampsia in first trimester of pregnancy.
25670721 Demonstrate the presence of LH receptors. Activation resulted in a dose-dependent increase in glucose-induced release of insulin.
25649397 This is the first study to confirm the association of novel LHCGR and FSHR SNPs with PCOS. The differential association of LHCGR and FSHR variants with PCOS confirms the racial/ethnic contribution to their association with PCOS.
25592315 A high prevalence of endometriosis, polymorphism in the LHCGR and GnRH1 and progonadoliberin-2 antibodies in serum was found among the patients with severe dysmotility after treatment with GnRH analogs.
25565299 Our aim was to study the association of LHCGR polymorphism (rs2293275) with PCOS
25393079 Silencing luteinizing hormone receptor expression suppresses androgen synthesis in prostate cancer cells.
25079470 Case Report: LHCGR nonsense mutation in an adult 46,XY female patient causing severe Leydig cell hypoplasia.
25010708 Data indicate that all solid pseudopapillary tumor of the pancreas {SPT) presented membranous and cytoplasmic staining for luteinizing hormone receptor (LH receptor).
24874553 Data suggest LHR expression is up-regulated in granulosa cells and theca cells of early antral follicles, as follicles grow/mature, and in corpus luteum; low but significant expression of LHR is exhibited in cumulus cells (but not in stromal cells).
24747085 miR-513a-3p is involved in the control of the LHCGR expression by an inversely regulated mechanism at the post-transcriptional level.
24592983 genetic association study (case-control study) in population in Egypt: Data suggest that an SNP in LHCGR (rs2293275) is associated with polycystic ovary syndrome (PCOS); homozygous 935A women are at higher risk to develop PCOS.
24554412 results of the experiments showed that hCGbeta action leads to the increase in ERK and AKT kinases phosphorylation in cancer cells and indicate that these biological effects can be achieved independently of human chorionic gonadotropin presence
24527662 hypomethylation of LHCGR is a potential mechanism underlying susceptibility to polycystic ovary syndrome
24438591 Examined the mechanisms of receptor signaling, intermolecular cooperation and intramolecular cis-activation. LHR-delExon10 was combined with LHR Lys605-->Glu, in which signaling is abolished, and the LHR mutant Cys131-->Arg, in which binding is deficient.
24365330 Although luteinizing hormone and chorionic gonadotropin bind to a common receptor, emerging evidence suggests that they have disparate effects on downstream signaling cascades. (Review)
24283620 Data (including data from subjects with mutations) suggest that signaling via LHCGR by luteinizing hormone and chorionic gonadotropin plays physiological roles in human development and pathophysiological roles in reproductive disorders. [REVIEW]
24014605 LHCGR and 17alpha-hydroxylase/17-20-lyase (CYP17A1) protein levels are increased in polycystic ovaries (PCOs).
23990106 during recovery from LH receptor desensitization, LH receptors are both located with DRM lipid environments and confined within small, mesoscale (80-160 nm) cell-surface compartments
23951246 High expression/ activation of GPER, and low expression of LHCGR/FSHR correlate with significantly greatly survival in ovarian epithelial cancer patients.
23884663 Regarding LHR, three patients were heterozygous for the known variant Glu354Lys and two for Ile374Thr. Intronic polymorphisms were not identified
23883350 this is the first report suggesting that LHCGR genetic variation might function in patient risk for ovarian hyperstimulation syndrome
23825122 Data suggest that physical association of recombinant LHR (lutropin receptor) and FSHR (follitropin receptor) into heterodimeric complexes exhibits a pattern of cross-attenuation of signaling by each receptor and its hormone.
23779096 AdipoR2 is regulated by the LH receptor function via a cAMP dependent mechanism.
23433069 Expression levels of LHR-associated protein are determined in granulosa-luteal cells by real-time reverse-transcription (PCR).
23285091 A complex neuroendocrine circuit exists in the retina, involving hCG secreting cells, hCG targets and hCG-release controlling cells.
23225038 A novel point mutation of the LHCGR gene has been identified in a family affected with FMPP. The c.1703C>T mutant LHCGR was confirmed to be constitutively active, which has led to maturation and proliferation of Leydig cells.
23118426 The gene products LHCGR and FSHR therefore are likely to be important in the etiology of PCOS, regardless of ethnicity.
23071612 The LHCGR is able to differentiate the activity of luteinizing hormone and chorionic gonadotropin.
23044874 Mutations in LHCGR are relatively rare causes of mild and severe forms of hypergonadotropic hypogonadism or disorders of sex development leading to infertility, both male and female. [REVIEW]
22902918 Our results suggest that SNPs rs2479106 in gene DENND1A and rs13405728 in gene LHCGR are associated with endometrioid adenocarcinoma.
22882535 case-control study comprising 651 TC cases and 313 controls in a Norwegian population was conducted for investigation of polymorphisms in the LHR, SRD5A and AR genes and their possible association with TC
22659248 The LHR gene is expressed in granulosa cell of human antral follicles throughout the follicular phase and is significantly associated with expression of the CYP19a1 gene.
22546001 The LHR rs61996318 SNP maybe highly conserved in Chinese Han women.
22369774 Case Report: heterozygous inactivating mutation in the LHCGR gene associated with amenorrhea, low oocyte yield, and recurrent pregnancy loss.
22356187 The presence of at least one 312N allele was strongly associated with polycystic ovary syndrome risk.
22355044 The average expression of AMH was significantly higher in egg donors and the average expression of LHCGR was significantly higher in DOR patients.
22309849 Data report two antibodies, scFv 13B1 and MAb PD1.37, against the hinge regions of LHR and TSHR, respectively, which have similar epitopes but different effects on receptor function.
22260850 High expression of luteinizing hormone receptors messenger RNA by human cumulus granulosa cells is in correlation with decreased fertilization.
22245602 The results suggest that polymorphisms in ESR1, ESR2 and LHCGR contribute to the risk of developing testicular germ cell cancer, histological subtype, and risk to metastasis.
22207559 FSH and LH receptors were found in normal postmenopausal ovaries
22002533 The results indicated that LHR-Del7 does not have negative effect on LHR-WT cell surface expression, and although the pathological splicing variant LHR-Del7 was able to localize to cell membranes it failed to bind hCG and had no effect on wild-type LHR.
21989932 the structurally uncharacterized C-terminal domain of LHR extracellular domain can no longer be considered to be an inert structural element of the receptor
21720050 Paper describes the first application of prenatal diagnosis in LHCGR deficiency for 46,XY disorders of sex development with the subsequent delivery of a normal baby.
21711548 Ovarian cancer cells transfected to express functional LHR showed the differential expression of 1,783 genes in response to LH treatment.
21690095 Restricted lateral diffusion of luteinizing hormone receptors in membrane microdomains.
21683950 Case Report: Mutation impairing the function of LHCGR may be responsible for empty follicle syndrome.
21622536 C terminus of Galpha(s) was found to be necessary for LHR and beta(2)-AR signaling.
21575145 Cultured human early pregnancy placental explants also released LHCGR via microvesicles.
21490077 the somatic D578H-LHR mutation in the LHR gene was observed in the majority of the patients with Leydig cell adenoma and in a patient with nodular Leydig cell hyperplasia in both testes
21330483 Data suggest that a subset of patients with primary aldosteronism has aberrant LHR and GNRHR expression, which could modulate aldosterone secretion.
21193408 findings demonstrated a critical aspect of LHR modulation whereby PC4 acts as a coactivator of Sp1 to contribute to the human of LHR transcription
21147848 data show that LH-regulated ERK1/2 signaling is required for the LRBP-mediated down-regulation of LHR mRNA
20835841 Results identify key amino acids that are part of the regulatory network responsible for propagating communication between the extracellular and intracellular poles of the luteinizing hormone receptor.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20716560 Observational study of gene-disease association. (HuGE Navigator)
20646984 chronically elevated levels, along with unknown genetic and epigenetic changes, may also lead to the formation of tumors that can secrete all three major classes of adrenal steroid hormones
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20570710 [review] LHR expression in the ovary is regulated by a post-transcriptional mechanism mediated by mevalonate kinase thereby linking LHR expression with cholesterol metabolism.
20444430 recent advances in our understanding of LHR structure and structure-function [REVIEW] relationships, as well as hormone-mediated changes in gene expression in ovarian cancer cells
20424473 Observational study of gene-disease association. (HuGE Navigator)
20374734 This review is intended to provide a brief, general overview of LHCGR.
20173016 Observational study of gene-disease association. (HuGE Navigator)
19636197 overexpression of human chorionic gonadotropin receptor is associated with adrenocorticotropin-independent Cushing's syndrome in pregnancy.
19616090 A profoundly signaling impaired hLHR(D405N,Y546F) mutant, when co-expressed with either wild type or active mutant, attenuates signaling of the latter and this is due to the formation of receptor heterodimers.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19574343 Observational study of gene-disease association. (HuGE Navigator)
19551906 report expands the genotypic spectrum of LHCGR mutations, with relevant implications for the molecular analysis of this gene.
19508998 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19492585 We found a heterozygous mutation of the LHR gene in a prepubertal child with testotoxicosis.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19403562 Observational study of gene-disease association. (HuGE Navigator)
19394610 Higher adiposity and younger gynecological age predict rapid luteinizing hormone secretion with increased pulse frequency. [2] The early years after menarche represent a vulnerable window for an exaggerated LHPF with weight gain.
19356624 LH receptors are undetectable in 62% of breast tumor samples and 41 of 42 breast cancer cell line
19246536 Expression of LHR splice variants is regulated in the human corpora lutea. During functional luteolysis a truncated variant could modulate the cell surface expression and activity of full-length LHR.
19147490 hLHR dimers/oligomers are formed early in the biosynthetic pathway in the ER, are constitutively expressed on the plasma membrane, and are not affected by the activation state of the hLHR.
19129711 Inactivating mutations of luteinizing hormone beta-subunit or luteinizing hormone receptor cause oligo-amenorrhea and infertility in women.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19010824 study showed in ovarian cancer cells LHR expression & activation upregulate ErbB-2 expression; data establish role for LH & LHR in regulation of ErbB-2 expression & suggest ErbB-2 upregulation alone is insufficient in producing aggressive phenotype
18971217 very low levels of LHCGR expression were found in all adult adrenocortical carcinomas.
18848524 These results suggest that the extracellular domain of the LHR is one of the determinants that confer its ability for proper maturation and cell surface expression.
18772599 Sexual pseudo-precocity caused by a somatic activating mutation of the LH receptor preceding true sexual precocity.
18767927 Observational study of gene-disease association. (HuGE Navigator)
18758818 Sensitivity of breast cancer cells to hormones that target the LH receptor may favor invasive breast cancer.
18647647 These results show that, in MA-10 cells, the hLHR activates Fyn through an arrestin-3-dependent pathway and that this pathway is a mediator of the hLHR-provoked release of EGF-like growth factors.
18641392 Asp(330) and Tyr(331) are key amino acids in LH/hCG mediated signaling
18596044 dissociation of serine/threonine protein phosphatases PP2A and PP1 from the LHR promoter mediates TSA-induced activation of LHR gene transcription in a cell-specific manner
18508780 LHR mutations may represent an underestimated cause of infertility in women, in addition to being responsible for male hypogonadism with reduced spermatogenesis
18439297 We report the discovery of a genetic interaction between APOE and LHCGR alleles that is associated with a significantly decreased risk for Alzheimer's disease in males
18439297 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18433292 findings identify a new, functional exon in the LHCGR gene and show that mutations in this exon cause some cases of Leydig cell hypoplasia
18411916 Co-expression of LH/hCGR and hCG protein in individual cancer cells may point to an autocrine or paracrine mechanism of _hCG activity in the tumor microenvironment.
18372343 A novel regulatory signaling mechanism of transcriptional control in which the LHR is derepressed through PKCalpha/ERK-mediated Sp1 phosphorylation, causing the release of HDAC1/mSin3A complex from the promoter.
18313839 Data show that mutations of the lutropin/choriogonadotropin receptor that do not activate the phosphoinositide cascade allow hCG to induce aromatase expression in immature rat granulosa cells.
18300940 The S312N SNP in exon 10 (rs2293275) was significantly less frequent in men with maldescended testes than in controls.
18300940 Observational study of gene-disease association. (HuGE Navigator)
18217981 LH/hCGR, coexpressed with hCGbeta, may act as a potential mediator of hCG action in nontrophoblastic gynecological cancers
18162522 An intracellular loop (IL2) residue confers different basal constitutive activities to the human lutropin receptor and human thyrotropin receptor through structural communication between IL2 and helix 6, via helix 3.
17709176 Observational study of gene-disease association. (HuGE Navigator)
17709176 Although functional changes of the LHR 291Ser candidate allele were observed, no associations with breast cancer were found, while the LHR 312Asn allele can be regarded as a weak breast cancer risk allele.
17692113 Observational study of gene-disease association. (HuGE Navigator)
17609213 study shows FSHR constitutively activating mutants (CAMs) not as active as LHR CAMs with comparable mutation; all FSHR CAMs showed strong promiscuous activation by high concentration of other glycoprotein hormone receptors; LHR CAMs showed little or none
17556863 Rhes inhibits functional activity (cyclic AMP production) of LHR.
17548147 In Ishikawa cells LH/hCG does not utilize its conventional receptor.
17458905 This study characterized the human trophoblastic luteinizing hormone/chorionic gonadotropin receptor and investigated its expression using the in vitro model of human cytotrophoblast differentiation into syncytiotrophoblast.
17293445 Ectodomain has major function apart from hormone binding, also interacts with transmembrane domain.
17092637 These results reveal a novel mechanism of regulation for gonadotropin receptor expression.
17074323 Observational study of gene-disease association. (HuGE Navigator)
17055147 REVIEW: novel insights into the properties of target cells expressing activating hLHR mutants and into the structural basis for hLHR activation
17052834 Molecular dynamics simulations on the isolated receptor and computational modeling of LHR homodimerization suggest that mutation-induced LHR activation favors H4-H4 contacts involving the highly conserved W491 from both the receptors monomers.
17045394 The data presented here support the model of glycoprotein hormone-receptor interaction in which the hormone binds to the extracellular domain through the beta subunit and then the alpha subunit is brought in contact with the transmembrane domain.
17045393 In the absence of ligand, constitutively active receptors are self-associated and located in high buoyancy membrane fractions, both characteristics of the hormone-treated wild type receptor.
16943418 These studies have revealed a novel mechanism of Trichostatin A action through derecruitment of a repressor from the Luteinizing hormone receptor gene promoter in a PI3K/PKCzeta-induced Sp1 phosphorylation-dependent manner.
16837644 Decidualization results in the downregulation of LHCGR.
16709601 LHR I114F mutation reduces ligand binding and signal transduction, and is partially responsible for Leydig cell hypoplasia
16332935 LH receptor expression is elevated in aldosterone-producing adenomas, which makes LH a potential cause of the excessive production of aldosterone in a subset of these adrenal tumors.
16135786 Epigenetic silencing and activation of the LHR gene is achieved through coordinated histone acetylation and promoter DNA methylation.
15908694 the structural trigger of the constitutive activity of the L457R mutant of the lutropin receptor may also be responsible for its lack of hormone responsiveness
15890674 human follitropin (FSH) receptor association with splicing variant of human lutropin/choriogonadotropin receptor negatively controls the expression of human FSH receptor
15889138 Lutropin receptors form homo- and heterodimers, via interactions involving primarily their heptahelical domains. The large hormone-binding ectodomains were dispensable for dimerization but modulated protomer interaction. The dimers show allosterism.
15878956 activation of the LHR results from subtle modifications of intramolecular interactions between the two domains and low-affinity binding of hCG to the extracellular loops or residues preceding the first transmembrane segment
15788387 SP factors play an intimate part in transcriptional regulation of the this receptor gene.
15607529 Leydig cell hypoplasia due to inactivation of luteinizing hormone receptor by a novel homozygous nonsense truncation mutation in the seventh transmembrane domain
15539429 palmitoylation of cysteine residues 643 and 644 of the human LHR is a determinant of recycling
15304512 contacts between the small seatbelt loop of alpha-human choriogonadotropin and the lutropin receptor involve its backbone atoms and possibly the side chain of residue betaAsp-99
15304492 characterization of the position of conserved alpha-subunit regions in lutropin receptor complexes
15292356 demonstrated the presence of LH/hCG receptor mRNA and protein in normal male breast tissue obtained at autopsy and archival samples of benign gynecomastia and male breast carcinoma
15169923 These data do not support the hypothesis that qualitative changes in LH receptor splicing have a role in luteolysis or that a naturally occurring LH receptor lacking exon 10 has a role in maternal recognition of pregnancy.
15084485 H295R cells contain LH/hCG receptors, which are coupled to increasing DHEAS secretion through upregulating the dhea sulfotransferase enzyme mRNA level
15031322 splice variant of the human luteinizing hormone (LH) receptor modulates the expression of wild-type human LH receptor
15016840 analysis of mutations in human luteinizing hormone receptor
14764820 Fetal kidney, liver, pancreas, lung, small and large intestines, and adrenals contained hCG/LH receptors. May mediate pleiotropic actions of hCG in growing human fetus.
14605099 a novel, noncontiguous, transferable motif that participates in the sorting of internalized G protein-coupled receptors
14594799 cell surface human lutropin receptor self-associates
14507927 characterization of interaction with GAIP-interacting protein C terminus
12972613 The LHR gene promoter is repressed by cross talk among the transcription factors EAR3, SP1 and TFIIB.
12933660 the G proteins activated by constitutively active mutants of the hLHR associated with Leydig cell hyperplasia or tumors are identical and are the same as those activated by the agonist-engaged hLHR-wt.
12850276 results of mutagenesis and buffer studies suggest that electrostatic effects contribute to ligand binding and/or that the LHR ectodomain may exist in two conformations, one being more accessible to ligand at reduced ionic strength.
12843195 human cervix contains functional LH/hCG receptors, which suggests that LH during the menstrual cycle and hCG during pregnancy may regulate cervical functions.
12816543 In human ovaries, MAb found 6 distinct LHR bands migrating at approximately 92, 80, 68, 59, 52 & 48 kDa. There is a possible role for LHR in the development of abnormal pregnancy, pelvic floor disorders & Alzheimer's disease.
12770743 Point mutations in the hinge region or ligand binding could cause conformational changes in the transmembrane region that result in Gs activation.
12727981 although exon 10 of the luteinizing hormone receptor plays no role in ligand binding, it is important for receptor activation by LH by a mechanism probably involving extracellular conformational changes
12679452 Observational study of gene-disease association. (HuGE Navigator)
12679452 findings suggest that the luteinizing hormone receptor 18insLQ gene polymorphism determines an earlier age of disease onset and is prognostic for poor outcome of breast cancer
12519858 LH-responsive Cushing's syndrome, associated with bilateral adrenal hyperplasia, may result from aberrant (or possibly increased) adrenal LH receptor expression.
12450321 Structure of LH receptor based on molecular modeling and the supporting experimental data from engineered and naturally occurring mutations. (review)
12444891 Homozygous mutation within the conserved Ala-Phe-Asn-Glu-Thr motif of exon 7 of the LH receptor causes male pseudohermaphroditism.
12270268 LH receptor gene expresses in normal endometrium at very low levels, and at increased levels in endometrial cancerous tissues compared with surrounding microscopically normal tissues
12242044 study of the conformations of the active and inactive states of the hLHR
12091390 HDAC-Sin3A complex regulates LHR Gene transcription
12088926 Evidence that luteinising hormone receptor polymorphisms may contribute to male undermasculinisation.
12040016 Cis- and trans-activation of hormone receptors: the LH receptor
11988313 review of the mechanism of desensitization to LH mediated by extensive clustering and internalization of the LH hormone-receptor complex
11857565 Results confirm the fact that somatic activating mutations of gonadotropin receptors are involved in gonadal tumorigenesis.

AA Sequence

MKQRFSALQLLKLLLLLQPPLPRALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPVKVIPSQAFR      1 - 70
GLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPD     71 - 140
VTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHL    141 - 210
EKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCC    211 - 280
AFRNLPTKEQNFSHSISENFSKQCESTVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAF    281 - 350
NPCEDIMGYDFLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDS    351 - 420
QTKGQYYNHAIDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRLRHAILIMLGG    421 - 490
WLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFFIICACYIKIYFAVRNPELMA    491 - 560
TNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPINSCANPFLYAIFTKTF    561 - 630
QRDFFLLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHCQGTALLDKTRYTEC     631 - 699
//

Text Mined References (209)

PMID Year Title
26831561 2015 Testotoxicosis: Report of Two Cases, One with a Novel Mutation in LHCGR Gene.
26679164 2015 miRNA-592 is downregulated and may target LHCGR in polycystic ovary syndrome patients.
26663062 2015 [Association of rs13405728 polymorphism of LHR gene with slow ovarian response].
26662070 2016 Association between genes encoding components of the Leutinizing hormone/Luteinizing hormone-choriogonadotrophin receptor pathway and polycystic ovary syndrome in Egyptian women.
26112185 2015 The LH/CG receptor activates canonical signaling pathway when expressed in Drosophila.
25935136 2015 LH (Trp8Arg/Ile15Thr), LHR (insLQ) and FSHR (Asn680Ser) polymorphisms genotypic prevalence in women with endometriosis and infertility.
25916694 2015 Melatonin and male reproduction.
25795638 2015 A novel inactivating mutation of the LH/chorionic gonadotrophin receptor with impaired membrane trafficking leading to Leydig cell hypoplasia type 1.
25676660 2015 Forms of Circulating Luteinizing Hormone Human Chorionic Gonadotropin Receptor for the Prediction of Early and Late Preeclampsia in the First Trimester of Pregnancy.
25670721 2015 The Presence of Human Chorionic Gonadotropin/Luteinizing Hormone Receptors in Pancreatic ?-Cells.
25649397 2015 Leutinizing hormone/choriogonadotropin receptor and follicle stimulating hormone receptor gene variants in polycystic ovary syndrome.
25592315 2015 Severe gastrointestinal dysmotility developed after treatment with gonadotropin-releasing hormone analogs.
25565299 2015 Association of luteinizing hormone chorionic gonadotropin receptor gene polymorphism (rs2293275) with polycystic ovarian syndrome.
25393079 2015 Effects of luteinizing hormone receptor signaling in prostate cancer cells.
25079470 Insights into the coexistence of two mutations in the same LHCGR gene locus causing severe Leydig cell hypoplasia.
25010708 2014 Immunohistochemical expression of luteinizing hormone receptor in solid pseudopapillary tumor of the pancreas.
24874553 2014 Localization of luteinizing hormone receptor protein in the human ovary.
24747085 2014 MicroRNA miR-513a-3p acts as a co-regulator of luteinizing hormone/chorionic gonadotropin receptor gene expression in human granulosa cells.
24592983 2014 Association of the luteinizing hormone/choriogonadotropin receptor gene polymorphism with polycystic ovary syndrome.
24554412 2014 CGB activates ERK and AKT kinases in cancer cells via LHCGR-independent mechanism.
24527662 2014 Hypomethylation of the LH/choriogonadotropin receptor promoter region is a potential mechanism underlying susceptibility to polycystic ovary syndrome.
24438591 2014 Differences between lutropin-mediated and choriogonadotropin-mediated receptor activation.
24365330 2014 Luteinizing hormone and human chorionic gonadotropin: origins of difference.
24283620 2014 Luteinizing hormone and human chorionic gonadotropin: distinguishing unique physiologic roles.
24014605 2013 Increased protein expression of LHCG receptor and 17?-hydroxylase/17-20-lyase in human polycystic ovaries.
23990106 2014 Luteinizing hormone receptors are confined in mesoscale plasma membrane microdomains throughout recovery from receptor desensitization.
23951246 2013 The G-protein coupled estrogen receptor (GPER/GPR30) is a gonadotropin receptor dependent positive prognosticator in ovarian carcinoma patients.
23884663 2013 Alterations of the FSH and LH receptor genes and evaluation of sperm ultrastructure in men with idiopathic hypergonadotropic hypogonadism.
23883350 2013 Association between the luteinizing hormone/chorionic gonadotropin receptor (LHCGR) rs4073366 polymorphism and ovarian hyperstimulation syndrome during controlled ovarian hyperstimulation.
23825122 2013 Heterodimerization between the lutropin and follitropin receptors is associated with an attenuation of hormone-dependent signaling.
23779096 2013 Activation of the LH receptor up regulates the type 2 adiponectin receptor in human granulosa cells.
23433069 2013 Analysis of androgen receptor and anti-Müllerian hormone pathways in human granulosa cells under luteinizing hormone treatment.
23285091 2012 Chorionic gonadotropin and its receptor are both expressed in human retina, possible implications in normal and pathological conditions.
23227193 2012 Analysis of copy number variation in Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
23225038 2012 [Analysis of a family affected with familial male-limited precocious puberty due to a Ala568Val mutation in LHCGR gene].
23118426 2013 Evidence for chromosome 2p16.3 polycystic ovary syndrome susceptibility locus in affected women of European ancestry.
23071612 2012 LH and hCG action on the same receptor results in quantitatively and qualitatively different intracellular signalling.
23044874 2012 Inactivating mutations of the human luteinizing hormone receptor in both sexes.
22902918 2012 Variants in DENND1A and LHCGR are associated with endometrioid adenocarcinoma.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
22882535 2012 Variations in testosterone pathway genes and susceptibility to testicular cancer in Norwegian men.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
22659248 2012 LH-receptor gene expression in human granulosa and cumulus cells from antral and preovulatory follicles.
22546001 2012 Association of the genetic variants of luteinizing hormone, luteinizing hormone receptor and polycystic ovary syndrome.
22369774 2012 A novel luteinizing hormone/chorionic gonadotropin receptor mutation associated with amenorrhea, low oocyte yield, and recurrent pregnancy loss.
22356187 2012 The 312N variant of the luteinizing hormone/choriogonadotropin receptor gene (LHCGR) confers up to 2·7-fold increased risk of polycystic ovary syndrome in a Sardinian population.
22355044 2012 Ovarian reserve status in young women is associated with altered gene expression in membrana granulosa cells.
22309849 2012 Insights into differential modulation of receptor function by hinge region using novel agonistic lutropin receptor and inverse agonistic thyrotropin receptor antibodies.
22260850 2012 High expression of luteinizing hormone receptors messenger RNA by human cumulus granulosa cells is in correlation with decreased fertilization.
22245602 2012 Association of polymorphisms in genes encoding hormone receptors ESR1, ESR2 and LHCGR with the risk and clinical features of testicular germ cell cancer.
22207559 2012 Analysis of pituitary gonadotropin concentration in blood serum and immunolocalization and immunoexpression of follicle stimulating hormone and luteinising hormone receptors in ovaries of postmenopausal women.
22002533 2012 Functional study of an aberrant splicing variant of the human luteinizing hormone (LH) receptor.
21989932 2011 Docking and free energy simulations to predict conformational domains involved in hCG-LH receptor interactions using recombinant antibodies.
21720050 2011 Identification by array-Comparative Genomic Hybridization (array-CGH) of a large deletion of luteinizing hormone receptor gene combined with a missense mutation in a patient diagnosed with a 46,XY disorder of sex development and application to prenatal diagnosis.
21711548 2011 Regulation of gene expression in ovarian cancer cells by luteinizing hormone receptor expression and activation.
21690095 2011 Restricted lateral diffusion of luteinizing hormone receptors in membrane microdomains.
21683950 2011 Inherited mutation of the luteinizing hormone/choriogonadotropin receptor (LHCGR) in empty follicle syndrome.
21622536 2011 The extreme C-terminal region of G?s differentially couples to the luteinizing hormone and beta2-adrenergic receptors.
21575145 2011 Microvesicle-mediated release of soluble LH/hCG receptor (LHCGR) from transfected cells and placenta explants.
21490077 2011 Mutation analysis of the LH receptor gene in Leydig cell adenoma and hyperplasia and functional and biochemical studies of activating mutations of the LH receptor gene.
21330483 2011 A case of primary aldosteronism in pregnancy: do LH and GNRH receptors have a potential role in regulating aldosterone secretion?
21193408 2011 Coactivator function of positive cofactor 4 (PC4) in Sp1-directed luteinizing hormone receptor (LHR) gene transcription.
21151128 2011 Genome-wide association study identifies susceptibility loci for polycystic ovary syndrome on chromosome 2p16.3, 2p21 and 9q33.3.
21147848 2011 Luteinizing hormone receptor mRNA down-regulation is mediated through ERK-dependent induction of RNA binding protein.
20835841 2011 Conserved amino acids participate in the structure networks deputed to intramolecular communication in the lutropin receptor.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20716560 2010 Genetic variation within the hypothalamus-pituitary-ovarian axis in women with recurrent miscarriage.
20646984 2010 Human adrenal LH/hCG receptors and what they could mean for adrenal physiology and pathology.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20570710 2010 Molecular regulation of gonadotropin receptor expression: relationship to sterol metabolism.
20444430 2010 The luteinizing hormone receptor: insights into structure-function relationships and hormone-receptor-mediated changes in gene expression in ovarian cancer cells.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20374734 2009 Diseases associated with mutations of the human lutropin receptor.
20173016 2010 Effect of polymorphisms in selected genes involved in pituitary-testicular function on reproductive hormones and phenotype in aging men.
19636197 2009 Adrenocorticotropin-independent Cushing's syndrome in pregnancy related to overexpression of adrenal luteinizing hormone/human chorionic gonadotropin receptors.
19616090 2009 A cell surface inactive mutant of the human lutropin receptor (hLHR) attenuates signaling of wild-type or constitutively active receptors via heterodimerization.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19551906 2009 A splice site mutation combined with a novel missense mutation of LHCGR cause male pseudohermaphroditism.
19508998 2009 Genome-wide association study in premature ovarian failure patients suggests ADAMTS19 as a possible candidate gene.
19492585 2009 Mother-to-son transmission of a luteinizing hormone receptor activating mutation in a prepubertal child with testotoxicosis.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19403562 2009 Genetic polymorphisms of GnRH and gonadotrophic hormone receptors affect the phenotype of polycystic ovary syndrome.
19394610 2010 Impact of fatness, insulin, and gynecological age on luteinizing hormone secretory dynamics in adolescent females.
19356624 2009 LH receptor gene expression is essentially absent in breast tumor tissue: implications for treatment.
19246536 2009 Differential expression and functional characterization of luteinizing hormone receptor splice variants in human luteal cells: implications for luteolysis.
19147490 2009 Bioluminescence resonance energy transfer studies reveal constitutive dimerization of the human lutropin receptor and a lack of correlation between receptor activation and the propensity for dimerization.
19129711 2009 Inactivating mutations of luteinizing hormone beta-subunit or luteinizing hormone receptor cause oligo-amenorrhea and infertility in women.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19010824 2008 Luteinizing hormone-induced up-regulation of ErbB-2 is insufficient stimulant of growth and invasion in ovarian cancer cells.
18971217 2009 Expression profiles of the glucose-dependent insulinotropic peptide receptor and LHCGR in sporadic adrenocortical tumors.
18848524 2008 The extracellular domain of luteinizing hormone receptor dictates its efficiency of maturation.
18772599 2008 Sexual pseudo-precocity caused by a somatic activating mutation of the LH receptor preceding true sexual precocity.
18767927 2009 Genetic variation in sex hormone genes influences heel ultrasound parameters in middle-aged and elderly men: results from the European Male Aging Study (EMAS).
18758818 2009 Beta-hCG/LH receptor (b-HCG/LH-R) expression is increased in invasive versus preinvasive breast cancer: implications for breast carcinogenesis?
18647647 2008 Arrestin-3 is essential for the activation of Fyn by the luteinizing hormone receptor (LHR) in MA-10 cells.
18641392 2008 Asp330 and Tyr331 in the C-terminal cysteine-rich region of the luteinizing hormone receptor are key residues in hormone-induced receptor activation.
18596044 2008 Unlocking repression of the human luteinizing hormone receptor gene by trichostatin A-induced cell-specific phosphatase release.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18508780 2008 A new LH receptor splice mutation responsible for male hypogonadism with subnormal sperm production in the propositus, and infertility with regular cycles in an affected sister.
18439297 2008 A luteinizing hormone receptor intronic variant is significantly associated with decreased risk of Alzheimer's disease in males carrying an apolipoprotein E epsilon4 allele.
18433292 2008 Mutations in a novel, cryptic exon of the luteinizing hormone/chorionic gonadotropin receptor gene cause male pseudohermaphroditism.
18411916 2007 [Assessment of expression of luteinizing hormone (LH)/human chorionic gonadotropin (hCG) receptor (LH/hCGR) and hCG protein in ovarian cancer tissues].
18372343 2008 Protein kinase Calpha-induced derepression of the human luteinizing hormone receptor gene transcription through ERK-mediated release of HDAC1/Sin3A repressor complex from Sp1 sites.
18313839 2008 Mutations of the lutropin/choriogonadotropin receptor that do not activate the phosphoinositide cascade allow hCG to induce aromatase expression in immature rat granulosa cells.
18300940 2008 Polymorphisms of the luteinizing hormone/chorionic gonadotropin receptor gene: association with maldescended testes and male infertility.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18217981 Coexpression of human chorionic gonadotropin beta subunit and its receptor in nontrophoblastic gynecological cancer.
18162522 2008 An intracellular loop (IL2) residue confers different basal constitutive activities to the human lutropin receptor and human thyrotropin receptor through structural communication between IL2 and helix 6, via helix 3.
17709176 2007 Polymorphic variations in exon 10 of the luteinizing hormone receptor: functional consequences and associations with breast cancer.
17692113 2007 GnRH and LHR gene variants predict adverse outcome in premenopausal breast cancer patients.
17609213 2007 Intrinsic differences in the response of the human lutropin receptor versus the human follitropin receptor to activating mutations.
17556863 2007 Ras homolog enriched in striatum inhibits the functional activity of wild type thyrotropin, follicle-stimulating hormone, luteinizing hormone receptors and activating thyrotropin receptor mutations by altering their expression in COS-7 cells.
17548147 2007 Assessment of luteinizing hormone receptor function in an endometrial cancer cell line, Ishikawa cells in response to human chorionic gonadotrophin (hCG).
17458905 2007 Biochemical characterization and modulation of LH/CG-receptor during human trophoblast differentiation.
17293445 2007 A conformational contribution of the luteinizing hormone-receptor ectodomain to receptor activation.
17092637 2007 The effect of splice variant of the human luteinizing hormone (LH) receptor on the expression of gonadotropin receptor.
17074323 2007 Exclusion of coding-region mutations in luteinizing hormone and follicle-stimulating hormone receptor genes as the cause of ovarian hyperstimulation syndrome.
17055147 2007 Insights learned from L457(3.43)R, an activating mutant of the human lutropin receptor.
17052834 2007 Dimerization of the lutropin receptor: insights from computational modeling.
17045394 2007 The antigen binding sites of various hCG monoclonal antibodies show homology to different domains of LH receptor.
17045393 2007 Constitutively-active human LH receptors are self-associated and located in rafts.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16943418 2006 Phosphatidylinositol 3-kinase/protein kinase Czeta-induced phosphorylation of Sp1 and p107 repressor release have a critical role in histone deacetylase inhibitor-mediated derepression [corrected] of transcription of the luteinizing hormone receptor gene.
16837644 2006 Decidualization regulates the expression of the endometrial chorionic gonadotropin receptor in the primate.
16709601 2006 Biological effect of a novel mutation in the third leucine-rich repeat of human luteinizing hormone receptor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16332935 2006 Elevated expression of luteinizing hormone receptor in aldosterone-producing adenomas.
16135786 2005 Coordinated changes in DNA methylation and histone modifications regulate silencing/derepression of luteinizing hormone receptor gene transcription.
15908694 2005 The formation of a salt bridge between helices 3 and 6 is responsible for the constitutive activity and lack of hormone responsiveness of the naturally occurring L457R mutation of the human lutropin receptor.
15890674 2005 Association of human follitropin (FSH) receptor with splicing variant of human lutropin/choriogonadotropin receptor negatively controls the expression of human FSH receptor.
15889138 2005 Glycoprotein hormone receptors: link between receptor homodimerization and negative cooperativity.
15878956 2005 Zero-length cross-linking reveals that tight interactions between the extracellular and transmembrane domains of the luteinizing hormone receptor persist during receptor activation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15788387 2005 Regulation of expression of the chorionic gonadotropin/luteinizing hormone receptor gene in the human myometrium: involvement of specificity protein-1 (Sp1), Sp3, Sp4, Sp-like proteins, and histone deacetylases.
15607529 2005 Leydig cell hypoplasia due to inactivation of luteinizing hormone receptor by a novel homozygous nonsense truncation mutation in the seventh transmembrane domain.
15539429 2005 Evidence that palmitoylation of carboxyl terminus cysteine residues of the human luteinizing hormone receptor regulates postendocytic processing.
15472221 2004 Leydig cell hypoplasia: absent luteinizing hormone receptor cell surface expression caused by a novel homozygous mutation in the extracellular domain.
15372531 2004 A novel missense homozygous inactivating mutation in the fourth transmembrane helix of the luteinizing hormone receptor in leydig cell hypoplasia.
15304512 2004 Only a portion of the small seatbelt loop in human choriogonadotropin appears capable of contacting the lutropin receptor.
15304492 2004 Use of protein knobs to characterize the position of conserved alpha-subunit regions in lutropin receptor complexes.
15292356 2004 Presence of luteinizing hormone/human chorionic gonadotropin receptors in male breast tissues.
15169923 2004 Alternative splicing of the human luteal LH receptor during luteolysis and maternal recognition of pregnancy.
15084485 2004 Functional luteinizing hormone/chorionic gonadotropin receptors in human adrenal cortical H295R cells.
15031322 2004 A splice variant of the human luteinizing hormone (LH) receptor modulates the expression of wild-type human LH receptor.
15016840 2004 Insight into mutation-induced activation of the luteinizing hormone receptor: molecular simulations predict the functional behavior of engineered mutants at M398.
14764820 2004 Human fetal nongonadal tissues contain human chorionic gonadotropin/luteinizing hormone receptors.
14605099 2004 The postendocytotic trafficking of the human lutropin receptor is mediated by a transferable motif consisting of the C-terminal cysteine and an upstream leucine.
14594799 2004 Constitutive and agonist-dependent self-association of the cell surface human lutropin receptor.
14507927 2003 GIPC binds to the human lutropin receptor (hLHR) through an unusual PDZ domain binding motif, and it regulates the sorting of the internalized human choriogonadotropin and the density of cell surface hLHR.
12972613 2003 Repression of the luteinizing hormone receptor gene promoter by cross talk among EAR3/COUP-TFI, Sp1/Sp3, and TFIIB.
12933660 2003 A constitutively active somatic mutation of the human lutropin receptor found in Leydig cell tumors activates the same families of G proteins as germ line mutations associated with Leydig cell hyperplasia.
12850276 2003 The luteinizing hormone receptor: influence of buffer composition on ligand binding and signaling of wild type and mutant receptors.
12843195 2003 Human cervix contains functional luteinizing hormone/human chorionic gonadotropin receptors.
12816543 2003 Multiple luteinizing hormone receptor (LHR) protein variants, interspecies reactivity of anti-LHR mAb clone 3B5, subcellular localization of LHR in human placenta, pelvic floor and brain, and possible role for LHR in the development of abnormal pregnancy, pelvic floor disorders and Alzheimer's disease.
12770743 2003 Activation of the luteinizing hormone receptor in the extracellular domain.
12727981 2003 Absence of exon 10 of the human luteinizing hormone (LH) receptor impairs LH, but not human chorionic gonadotropin action.
12679452 2003 Luteinizing hormone signaling and breast cancer: polymorphisms and age of onset.
12519858 2003 Luteinizing hormone (LH)-responsive Cushing's syndrome: the demonstration of LH receptor messenger ribonucleic acid in hyperplastic adrenal cells, which respond to chorionic gonadotropin and serotonin agonists in vitro.
12450321 2002 Structural aspects of luteinizing hormone receptor: information from molecular modeling and mutagenesis.
12444891 2002 Homozygous mutation within the conserved Ala-Phe-Asn-Glu-Thr motif of exon 7 of the LH receptor causes male pseudohermaphroditism.
12270268 2002 Increased expression of human luteinizing hormone/human chorionic gonadotropin receptor mRNA in human endometrial cancer.
12242044 2002 Constitutive activation of the LH receptor is associated with an alteration in the conformation of the ectodomain.
12091390 2002 Silencing of transcription of the human luteinizing hormone receptor gene by histone deacetylase-mSin3A complex.
12088926 2002 Evidence that luteinising hormone receptor polymorphisms may contribute to male undermasculinisation.
12050206 2002 Mutant luteinizing hormone receptors in a compound heterozygous patient with complete Leydig cell hypoplasia: abnormal processing causes signaling deficiency.
12040016 2002 Cis- and trans-activation of hormone receptors: the LH receptor.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11988313 2002 Mechanisms of gonadotropin desensitization.
11943741 2002 The lutropin/choriogonadotropin receptor, a 2002 perspective.
11857565 2002 Mutational analysis of the luteinizing hormone receptor gene in two individuals with Leydig cell tumors.
11391350 2001 Nodular Leydig cell hyperplasia in a boy with familial male-limited precocious puberty.
11134146 2000 Gonadotropin-independent precocious puberty due to luteinizing hormone receptor mutations in Brazilian boys: a novel constitutively activating mutation in the first transmembrane helix.
10617611 2000 Seven non-contiguous intracellular residues of the lutropin/choriogonadotropin receptor dictate the rate of agonist-induced internalization and its sensitivity to non-visual arrestins.
10580072 1999 Leydig-cell tumors caused by an activating mutation of the gene encoding the luteinizing hormone receptor.
10493819 1999 The luteinizing hormone receptor activates phospholipase C via preferential coupling to Gi2.
10342833 1999 The alpha-subunit of human choriogonadotropin interacts with the exodomain of the luteinizing hormone/choriogonadotropin receptor.
10215412 1998 Polymorphisms in the coding exons of the human luteinizing hormone receptor gene. Mutations in brief no. 124. Online.
9858858 1999 Genomic distribution and gonadal mRNA expression of two human luteinizing hormone receptor exon 1 sequences in random populations.
9851790 1998 Evidences for an allelic variant of the human LC/CG receptor rather than a gene duplication: functional comparison of wild-type and variant receptors.
9661624 1998 A unique constitutively activating mutation in third transmembrane helix of luteinizing hormone receptor causes sporadic male gonadotropin-independent precocious puberty.
9626653 1998 A homozygous mutation in the luteinizing hormone receptor causes partial Leydig cell hypoplasia: correlation between receptor activity and phenotype.
9626144 1998 A novel mutation of the human luteinizing hormone receptor in 46XY and 46XX sisters.
9558473 1998 The luteinizing hormone receptor.
9514160 1998 A homozygous microdeletion in helix 7 of the luteinizing hormone receptor associated with familial testicular and ovarian resistance is due to both decreased cell surface expression and impaired effector activation by the cell surface receptor.
9467560 1998 A mutation in the first transmembrane domain of the lutropin receptor causes male precocious puberty.
9435458 1998 A novel human luteinizing hormone receptor gene.
9238862 1997 Interaction, signal generation, signal divergence, and signal transduction of LH/CG and the receptor.
9215288 1997 Comparison of immunocytochemical and molecular features with the phenotype in a case of incomplete male pseudohermaphroditism associated with a mutation of the luteinizing hormone receptor.
8929952 1996 A new point mutation in the luteinising hormone receptor gene in familial and sporadic male limited precocious puberty: genotype does not always correlate with phenotype.
8829636 1996 A missense (T577I) mutation in the luteinizing hormone receptor gene associated with familial male-limited precocious puberty.
8747461 1995 Structural predictions for the ligand-binding region of glycoprotein hormone receptors and the nature of hormone-receptor interactions.
8559204 1996 Brief report: testicular and ovarian resistance to luteinizing hormone caused by inactivating mutations of the luteinizing hormone-receptor gene.
8281137 1993 Cosegregation of missense mutations of the luteinizing hormone receptor gene with familial male-limited precocious puberty.
7757065 1995 Characterization of heterogeneous mutations causing constitutive activation of the luteinizing hormone receptor in familial male precocious puberty.
7719343 1995 Male pseudohermaphroditism due to a homozygous missense mutation of the luteinizing hormone receptor gene.
7714085 1995 A new constitutively activating point mutation in the luteinizing hormone/choriogonadotropin receptor gene in cases of male-limited precocious puberty.
7692306 1993 A constitutively activating mutation of the luteinizing hormone receptor in familial male precocious puberty.
7629248 1995 A novel mutation of the luteinizing hormone receptor gene causing male gonadotropin-independent precocious puberty.
7556872 1995 Structure of the human luteinizing hormone-choriogonadotropin receptor gene: unusual promoter and 5' non-coding regions.
3470775 1987 A receptor-binding region in human choriogonadotropin/lutropin beta subunit.
2791656 1989 Report of the committee on linkage and gene order.
2293030 1990 Isolation of TSH and LH/CG receptor cDNAs from human thyroid: regulation by tissue specific splicing.
2254302 1990 Extracellular domain of lutropin/choriogonadotropin receptor expressed in transfected cells binds choriogonadotropin with high affinity.
2249480 1990 Localization of the human luteinizing hormone/choriogonadotropin receptor gene (LHCGR) to chromosome 2p21.
2244890 1990 Cloning and sequencing of human LH/hCG receptor cDNA.
1922095 1991 Expression of human luteinizing hormone (LH) receptor: interaction with LH and chorionic gonadotropin from human but not equine, rat, and ovine species.
1651314 1991 Eleven amino acids (Lys-201 to Lys-211) and 9 amino acids (Gly-222 to Leu-230) in the human thyrotropin receptor are involved in ligand binding.