Property Summary

NCBI Gene PubMed Count 26
PubMed Score 196.63
PubTator Score 108.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Melorheostosis 3 6.867 3.4
Buschke-Ollendorff syndrome 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.9e-05
lung cancer 4740 5.5e-05
psoriasis 6694 1.2e-04
osteosarcoma 7950 1.2e-03
medulloblastoma, large-cell 6241 1.6e-03
subependymal giant cell astrocytoma 2287 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.500 5.5e-05
medulloblastoma, large-cell -1.200 1.6e-03
osteosarcoma -1.137 1.2e-03
ovarian cancer -1.200 1.9e-05
psoriasis -1.200 1.2e-04
subependymal giant cell astrocytoma -1.095 1.9e-02

 GO Function (1)

Gene RIF (21)

AA Sequence

MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRGNKTRNSNNNN      1 - 70
TAAATVAAAGPAAAAAAGMGVRPVSGDLSYLRTPGGLCRISASGPESLLGGPGGASAAPAAGSKVLLGFS     71 - 140
SDESDVEASPRDQAGGGGRKDRASLQYRGLKAPPAPLAASEVTNSNSAERRKPHSWWGARRPAGPELQTP    141 - 210
PGKDGAVEDEEGEGEDGEERDPETEEPLWASRTVNGSRLVPYSCRENYSDSEEEDDDDVASSRQVLKDDS    211 - 280
LSRHRPRRTHSKPLPPLTAKSAGGRLETSVQGGGGLAMNDRAAAAGSLDRSRNLEEAAAAEQGGGCDQVD    281 - 350
SSPVPRYRVNAKKLTPLLPPPLTDMDSTLDSSTGSLLKTNNHIGGGAFSVDSPRIYSNSLPPSAAVAASS    351 - 420
SLRINHANHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGSFSAHYLSMFLLTAACLFFLILGL    421 - 490
TYLGMRGTGVSEDGELSIENPFGETFGKIQESEKTLMMNTLYKLHDRLAQLAGDHECGSSSQRTLSVQEA    491 - 560
AAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPEEELTNITDVQFLQSTRPLMSFWCRFRRAFVT    561 - 630
VTHRLLLLCLGVVMVCVVLRYMKYRWTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVR    631 - 700
DSLIQPHDRKKMKKVWDRAVDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAF    701 - 770
HLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLS    771 - 840
PEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRLRTGLTNSQGS    841 - 910
S//

Text Mined References (36)

PMID Year Title