Property Summary

NCBI Gene PubMed Count 65
PubMed Score 298.76
PubTator Score 151.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.640 5.6e-03
Multiple myeloma 1.899 4.9e-04
primary pancreatic ductal adenocarcinoma -1.416 2.1e-03
intraductal papillary-mucinous adenoma (... -3.100 1.5e-05
intraductal papillary-mucinous carcinoma... -2.500 9.0e-03
intraductal papillary-mucinous neoplasm ... -3.500 1.5e-03
lung cancer -2.300 5.0e-06
group 4 medulloblastoma -1.500 2.2e-05
lung carcinoma -2.000 7.3e-19
breast carcinoma -1.100 1.0e-18
Breast cancer -1.800 1.1e-04
ductal carcinoma in situ -1.100 3.1e-03
invasive ductal carcinoma -1.400 2.1e-03
ovarian cancer -1.200 3.3e-02
pancreatic cancer -1.400 2.2e-03
dermatomyositis 1.400 3.8e-02

Protein-protein Interaction (3)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
743192 confirmatory 0 / 0 / 10 Extended Characterization of HPGD Inhibitors: Counterscreen Against LDHB

Gene RIF (37)

PMID Text
26214432 The aim of this study was to demonstrate the effects of 6-week low-intensity training on changes in indicators of aerobic capacity and on HSPA1A, HSPB1, and LDHb expression in white blood cells in high level rowers.
26032856 addition of exogenous lactic acid to growth media was sufficient to induce cell death that could be inhibited by the expression of LDHB. the results suggest that lactate dehydrogenase is a general suppressor of programmed cell death in yeast.
25973606 Lactate dehydrogenase B is associated with the response to neoadjuvant chemotherapy in oral squamous cell carcinoma.
25524555 In this study, we inhibited LDH using oxamate resulting in the inhibition of proliferation and induction of apoptosis in gastric cancer
25505242 The interaction of HIV-1 CA with human cellular lactate dehydrogenase B protein (LDHB) is identified by yeast two-hybrid screen
25247702 The readthrough-extended lactate dehydrogenase subunit LDHBx can also co-import LDHA, the other LDH subunit, into peroxisomes.
24708595 We were able to provide evidence that methylation of HLTF and especially HPP1 detected in serum is strongly correlated with cell death in CRC using LDH as surrogate marker
24682390 This meta-analysis shows that high serum LDH level is obviously associated with lower overall survival rate in patients with osteosarcoma, and it is an effective biomarker of prognosis.
23697991 These observations support prospective clinical evaluation of LDHB as a predictive marker of response for patients with breast cancer receiving neoadjuvant chemotherapy.
23516535 the role played by ERRalpha in the regulation of lactate dehydrogenases A and B
23437403 Loss of LDH-B expression is an early and frequent event in human breast cancer occurring due to promoter methylation, and is likely to contribute to an enhanced glycolysis of cancer cells under hypoxia.
23266049 ata indicate that serum lactic dehydrogenase (S-LDH) appears to be a significant independent prognostic index in patients with metastatic nasopharyngeal carcinoma (NPC).
23224736 This study identifies LDHB as a regulator of cell proliferation in a subset of lung adenocarcinoma and may provide a novel therapeutic approach for treating lung cancer
23202721 LDH concentrations in nasopharyngeal secretions are positively associated with acute otitis media risk.
23166591 The interaction of HIV-1 CA with human cellular lactate dehydrogenase B protein (LDHB) is identified by yeast two-hybrid screen
23139210 Data reveal that LDHB is upregulated and required only in certain cancer genotypes.
23125841 The interaction of HIV-1 CA with human cellular lactate dehydrogenase B protein (LDHB) is identified by yeast two-hybrid screen
22892192 Patients with severe vaso-occlusive crisis were more frequently males, who also had higher white blood cell (WBC) count, procalcitonin (PCT), and lactate dehydrogenase (LDH) levels.
22891270 Serum lactate dehydrogenase is a prognostic and predictive biomarker for survival benefit conferred by TORC1 inhibition in poor-risk renal cell carcinoma.
22807456 The interaction of HIV-1 CA with human cellular lactate dehydrogenase B protein (LDHB) is identified by yeast two-hybrid screen
22752059 results indicate that histone deacetylase inhibitors upregulate miRNAs, at least some of which act as tumor suppressors. lactate dehydrogenase B, which is regulated by the tumor suppressive miR-375, may therefore act as an oncogene in esophageal squamous cell carcinoma.
22461886 Data indicate that serum lactate dehydrogenase (LDH) seemed able to predict clinical outcome for hepatocellular carcinoma (HCC) patients undergoing hepatocellular carcinoma (HCC).
22248949 The significant elevation in serum CK [creatine kinase ]and LDH [L-Lactate Dehydrogenase ] activities indicates that these can be used as parameters for screening hypothyroid patients but not hyperthyroid patients.
22027740 results confirmed the prognostic roles of LDH-B in urinary bladder urothelial carcinoma.
21858537 Results show that S-100B, MIA and LDH levels were significantly higher in patients with advanced melanoma than in disease-free patients or healthy controls.
21356207 Results suggest that lactate dehydrogenase B suppression plays an important role in triggering or maintaining the mitochondrial defects and then contributes to cancer cell invasiveness by inducing claudin-1 protein.
21199794 findings offer proof of concept for targeting LDHB as a therapeutic strategy in cancers driven by aberrant activation of the RTK-PI3K-AKT-mTOR signaling cascade
20951115 Presented are QM/MM calculations that show differences in geometries of active sites of M(4) and H(4) isoforms of human LDH ligated with oxamate, pyruvate or L-lactate.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20592382 S100B and LDH are not expressed in sentinel node progression of melanoma
20499337 Elevated serum LDH isoenzymes and AST indicate a disturbance (of uncertain clinical significance) within multiple extraosseous tissues when there is CLCN7 deficiency.
18593994 MYC, LDHB, and CCNB1 may have roles in progression of medulloblastoma
17178662 LDHB was elevated in idiopathic myelofibrosis. This isoenzymatic pattern could be expression of a metabolic adaptation.
15710247 The interaction of HIV-1 CA with human cellular lactate dehydrogenase B protein (LDHB) is identified by yeast two-hybrid screen
12555229 Observational study of gene-disease association. (HuGE Navigator)
11582518 The interaction of HIV-1 CA with human cellular lactate dehydrogenase B protein (LDHB) is identified by yeast two-hybrid screen
11125887 The interaction of HIV-1 CA with human cellular lactate dehydrogenase B protein (LDHB) is identified by yeast two-hybrid screen

AA Sequence

MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGS      1 - 70
LFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNP     71 - 140
VDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGV    141 - 210
SLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKG    211 - 280
MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL                    281 - 334
//

Text Mined References (72)

PMID Year Title
26214432 2015 Effects of 6-week specific low-intensity training on selected aerobic capacity parameters and HSPA1A, HSPB1, and LDHb gene expression in high-level rowers.
26032856 2015 Inhibition of stress mediated cell death by human lactate dehydrogenase B in yeast.
25973606 2015 Lactate dehydrogenase B is associated with the response to neoadjuvant chemotherapy in oral squamous cell carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25524555 2015 Oxamate-mediated inhibition of lactate dehydrogenase induces protective autophagy in gastric cancer cells: involvement of the Akt-mTOR signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25340584 2014 Ribosomal readthrough at a short UGA stop codon context triggers dual localization of metabolic enzymes in Fungi and animals.
25247702 2014 Peroxisomal lactate dehydrogenase is generated by translational readthrough in mammals.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24708595 2014 Circulating cell-free methylated DNA and lactate dehydrogenase release in colorectal cancer.
24682390 2014 Prognostic significance of serum lactate dehydrogenase level in osteosarcoma: a meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23697991 2013 Lactate dehydrogenase B: a metabolic marker of response to neoadjuvant chemotherapy in breast cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23516535 2013 Estrogen-related receptor alpha modulates lactate dehydrogenase activity in thyroid tumors.
23437403 2013 Lactate dehydrogenase-B is silenced by promoter methylation in a high frequency of human breast cancers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23266049 2013 Serum lactic dehydrogenase strongly predicts survival in metastatic nasopharyngeal carcinoma treated with palliative chemotherapy.
23224736 2013 Lactate dehydrogenase B is required for the growth of KRAS-dependent lung adenocarcinomas.
23202721 2013 Lactate dehydrogenase as a marker of nasopharyngeal inflammatory injury during viral upper respiratory infection: implications for acute otitis media.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139210 2012 An integrated genomic screen identifies LDHB as an essential gene for triple-negative breast cancer.
22892192 2012 High lactate dehydrogenase levels at admission for painful vaso-occlusive crisis is associated with severe outcome in adult SCD patients.
22891270 2012 Serum lactate dehydrogenase predicts for overall survival benefit in patients with metastatic renal cell carcinoma treated with inhibition of mammalian target of rapamycin.
22752059 2012 Identification of novel molecular targets regulated by tumor suppressive miR-375 induced by histone acetylation in esophageal squamous cell carcinoma.
22461886 2012 The role of LDH serum levels in predicting global outcome in HCC patients undergoing TACE: implications for clinical management.
22248949 Serum creatine kinase and lactate dehydrogenase activities in patients with thyroid disorders.
22027740 2011 Loss of lactate dehydrogenase B subunit expression is correlated with tumour progression and independently predicts inferior disease-specific survival in urinary bladder urothelial carcinoma.
21858537 2011 Evaluation of multiple serum markers in advanced melanoma.
21356207 2011 Decreased lactate dehydrogenase B expression enhances claudin 1-mediated hepatoma cell invasiveness via mitochondrial defects.
21269460 2011 Initial characterization of the human central proteome.
21199794 2011 Lactate dehydrogenase B is critical for hyperactive mTOR-mediated tumorigenesis.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20951115 2011 Differences and similarities in binding of pyruvate and L-lactate in the active site of M4 and H4 isoforms of human lactate dehydrogenase.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20592382 2010 Serum S100B and LDH are not useful in predicting the sentinel node status in melanoma patients.
20499337 2010 Elevated serum lactate dehydrogenase isoenzymes and aspartate transaminase distinguish Albers-Schönberg disease (Chloride Channel 7 Deficiency Osteopetrosis) among the sclerosing bone disorders.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18593994 2008 Molecular risk stratification of medulloblastoma patients based on immunohistochemical analysis of MYC, LDHB, and CCNB1 expression.
17178662 2006 Increased serum lactate dehydrogenase isoenzymes in Ph-negative chronic myeloproliferative diseases: a metabolic adaptation?
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12555229 2003 Association of an exonic LDHA polymorphism with altered respiratory response in probands at high risk for panic disorder.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12160330 2002 Identification of breast cancer-restricted antigens by antibody screening of SKBR3 cDNA library using a preselected patient's serum.
11726686 2001 Misreading of termination codons in eukaryotes by natural nonsense suppressor tRNAs.
11509017 2001 A novel missense mutation in human lactate dehydrogenase B-subunit gene.
11276087 2001 Structural basis for altered activity of M- and H-isozyme forms of human lactate dehydrogenase.
10509905 1999 Genetic analyses in homozygous and heterozygous variants of lactate dehydrogenase-B (H) subunit--LD-B Matsumoto I and II (LD-B W323R).
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
10211631 1999 A novel in-frame deletion mutation in a case of lactate dehydrogenase (LD) H subunit deficiency showing an atypical LD isoenzyme pattern in serum and erythrocytes.
9929983 1999 First case of missense mutation (LDH-H:R171P) in exon 4 of the lactate dehydrogenase gene detected in a Japanese patient.
8611651 1996 Arginine to tryptophan substitution in the active site of a human lactate dehydrogenase variant--LDHB GUA1: postulated effects on subunit structure and catalysis.
8462975 1993 Detection and characterization of new genetic mutations in individuals heterozygous for lactate dehydrogenase-B(H) deficiency using DNA conformation polymorphism analysis and silver staining.
8314553 1993 Analysis of a genetic mutation in an electrophoretic variant of the human lactate dehydrogenase-B(H) subunit.
7821789 1994 Construction of a human full-length cDNA bank.
7273846 1981 The glucose-lactic acid cycle and gluconeogenesis.
3435492 1987 The cDNA and protein sequences of human lactate dehydrogenase B.
2930497 1989 Structure of the human lactate dehydrogenase B gene.
2334429 1990 A missense mutation found in human lactate dehydrogenase-B (H) variant gene.
1996957 1991 Properties of human testis-specific lactate dehydrogenase expressed from Escherichia coli.
1587525 1992 Molecular characterization of genetic mutations in human lactate dehydrogenase (LDH) B (H) variant.
1371976 1992 Human centrosomal epitope is shared specifically with human lactate dehydrogenase-B isozyme.
1081369 1975 [Increase of the LDH-B activity in a boy with 12p trisomy by malsegregation of a maternal translocation t(12;14) (q12;p11)].