Property Summary

Ligand Count 80
NCBI Gene PubMed Count 143
PubMed Score 1030.51
PubTator Score 280.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.200 4.8e-03

 GWAS Trait (1)

Protein-protein Interaction (2)

PDB (18)

Gene RIF (107)

AA Sequence

MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSL      1 - 70
FLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPV     71 - 140
DILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVS    141 - 210
LKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGL    211 - 280
YGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF                      281 - 332
//

Text Mined References (155)

PMID Year Title