Property Summary

NCBI Gene PubMed Count 42
PubMed Score 158.49
PubTator Score 59.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
nail-patella syndrome 16 4.318 2.2
Paraplegia 71 3.13 1.6

Expression

Gene RIF (12)

PMID Text
26598604 Alanine scanning mutagenesis of the LIM interaction domain of LDB1 revealed a discrete motif, R(320)LITR, required for LMO2 binding.
26495868 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic beta-Cell Target Genes
25079073 Clim2, in a complex with LMO4, supports mammary stem cells by directly targeting the Fgfr2 promoter in basal cells to increase its expression
23812588 In t(8;21) leukemia cells, LDB1 functions as a component of the stable AML1-ETO-containing transcription factor complex (AETFC). The AETFC components cooperatively regulate gene expression and contribute to leukemogenesis.
22010104 We investigated NLI (Ldb1 homolog) complex occupancy and chromatin conformation of the beta-globin locus in human erythroid cells.
20447379 These studies are consistent with a model in which TIF1gamma acts to ubiquitinate LDB1 leading to degradation of LDB1 and changes in transcription of LDB1-dependent promoters.
20423330 Expression of LDB1 (LIM-domain-binding 1) protein in which Lys134 is replaced with arginine leads to enhanced expression of the mutant protein compared with the wild-type protein.
18583962 Although the LIM interaction domain of Ldb1 (Ldb1(LID)) and Isl1(LBD) share low levels of sequence homology, X-ray and NMR structures reveal that they bind Lhx3 in an identical manner, that is, Isl1(LBD) mimics Ldb1(LID).
17910069 characterize the assembly of a five-component complex containing TAL1, LMO2, Ldb1, E12, and DNA. The bHLH domains of TAL1 and E12 alone primarily formed helical homodimers, but together formed heterodimers, to which LMO2 bound with high affinity
16385451 Observational study of gene-disease association. (HuGE Navigator)
12381786 Ssdp proteins interact with the LIM-domain-binding protein Ldb1 to regulate development
12153047 1H, 15N and 13C assignments of FLIN4, an intramolecular LMO4:ldb1 complex

AA Sequence

MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYR      1 - 70
IFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELY     71 - 140
YVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPR    141 - 210
SILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQR    211 - 280
MVAPPAEPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEF    281 - 350
GDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ             351 - 411
//

Text Mined References (50)

PMID Year Title
26598604 2015 LMO2 Oncoprotein Stability in T-Cell Leukemia Requires Direct LDB1 Binding.
26495868 2015 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic ?-Cell Target Genes.
25416956 2014 A proteome-scale map of the human interactome network.
25079073 2014 The co-factor of LIM domains (CLIM/LDB/NLI) maintains basal mammary epithelial stem cells and promotes breast tumorigenesis.
23812588 2013 A stable transcription factor complex nucleated by oligomeric AML1-ETO controls leukaemogenesis.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22010104 2011 Distinct Ldb1/NLI complexes orchestrate ?-globin repression and reactivation through ETO2 in human adult erythroid cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21076045 2011 Structure of the leukemia oncogene LMO2: implications for the assembly of a hematopoietic transcription factor complex.
20855495 2010 NKX3.1 is a direct TAL1 target gene that mediates proliferation of TAL1-expressing human T cell acute lymphoblastic leukemia.
20447379 2010 Transcription intermediary factor 1gamma decreases protein expression of the transcriptional cofactor, LIM-domain-binding 1.
20423330 2010 Regulation of LIM-domain-binding 1 protein expression by ubiquitination of Lys134.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19117995 2009 Regulation of estrogen-dependent transcription by the LIM cofactors CLIM and RLIM in breast cancer.
18583962 2008 Implementing the LIM code: the structural basis for cell type-specific assembly of LIM-homeodomain complexes.
17910069 2008 Assembly of the oncogenic DNA-binding complex LMO2-Ldb1-TAL1-E12.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16815859 2006 Spliced isoforms of LIM-domain-binding protein (CLIM/NLI/Ldb) lacking the LIM-interaction domain.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16314316 2005 Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14743429 2004 Identification of a protein that interacts with the golli-myelin basic protein and with nuclear LIM interactor in the nervous system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12792813 2003 Confirmation of CLIM2/LMX1B interaction by yeast two-hybrid screening and analysis of its involvement in nail-patella syndrome.
12727888 2003 Structural basis for the recognition of ldb1 by the N-terminal LIM domains of LMO2 and LMO4.
12642495 2003 Ssdp proteins bind to LIM-interacting co-factors and regulate the activity of LIM-homeodomain protein complexes in vivo.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12381786 2002 Ssdp proteins interact with the LIM-domain-binding protein Ldb1 to regulate development.
12153047 2002 1H, 15N and 13C assignments of FLIN4, an intramolecular LMO4:ldb1 complex.
11882901 2002 Ubiquitination-dependent cofactor exchange on LIM homeodomain transcription factors.
11751867 2002 The LIM domain protein LMO4 interacts with the cofactor CtIP and the tumor suppressor BRCA1 and inhibits BRCA1 activity.
10767331 2000 LMX1B transactivation and expression in nail-patella syndrome.
10640831 1999 Genomic structure, alternative transcripts and chromosome location of the human LIM domain binding protein 1 gene LDB1.
10083735 1999 Isolation and chromosomal assignment of human genes encoding cofactor of LIM homeodomain proteins, CLIM1 and CLIM2.
9872335 1998 The LMO1 and LDB1 proteins interact in human T cell acute leukaemia with the chromosomal translocation t(11;14)(p15;q11).
9799849 1998 Cloning and chromosomal localization of two novel human genes encoding LIM-domain binding factors CLIM1 and CLIM2/LDB1/NLI.
9736723 1998 Identification and characterization of LMO4, an LMO gene with a novel pattern of expression during embryogenesis.
9503020 1998 Genomic structure and chromosomal localization of the mouse LIM domain-binding protein 1 gene, Ldb1.
9452425 1998 The nuclear LIM domain interactor NLI mediates homo- and heterodimerization of LIM domain transcription factors.
9391090 1997 The LIM-domain binding protein Ldb1 and its partner LMO2 act as negative regulators of erythroid differentiation.
9315627 1997 Functional analysis of the nuclear LIM domain interactor NLI.
9214632 1997 The LIM-only protein Lmo2 is a bridging molecule assembling an erythroid, DNA-binding complex which includes the TAL1, E47, GATA-1 and Ldb1/NLI proteins.
9209374 1997 LIM-only protein Lmo2 forms a protein complex with erythroid transcription factor GATA-1.